Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DS59

Protein Details
Accession A0A371DS59   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-79SASWRQCRRCCCCCPRRRRRRDRGGGQRVRVHydrophilic
NLS Segment(s)
PositionSequence
64-77RRRRRRDRGGGQRV
Subcellular Location(s) mito 16, nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MRGFVLKARAGAEQRWVCLSMSRGGKSETISKSESGLGTDLSEVQSPRSASWRQCRRCCCCCPRRRRRRDRGGGQRVRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.29
4 0.25
5 0.25
6 0.26
7 0.22
8 0.26
9 0.26
10 0.25
11 0.25
12 0.26
13 0.25
14 0.31
15 0.26
16 0.24
17 0.24
18 0.23
19 0.23
20 0.23
21 0.21
22 0.15
23 0.13
24 0.1
25 0.08
26 0.08
27 0.07
28 0.06
29 0.07
30 0.07
31 0.07
32 0.1
33 0.1
34 0.1
35 0.15
36 0.18
37 0.23
38 0.33
39 0.43
40 0.49
41 0.57
42 0.65
43 0.69
44 0.73
45 0.77
46 0.77
47 0.78
48 0.79
49 0.83
50 0.85
51 0.88
52 0.92
53 0.94
54 0.94
55 0.95
56 0.96
57 0.96
58 0.96
59 0.96