Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CY57

Protein Details
Accession A0A371CY57    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
62-88LCFKSCGKRYSRRPDLRKHLLNKHGFRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MDGRIRRTVIETHNSVQLENGTSSSIQRLQALFKCHLCGYVSKKKYNVKTHIEVVHYNMKHLCFKSCGKRYSRRPDLRKHLLNKHGFRLGRGDSLPVGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.32
4 0.27
5 0.22
6 0.18
7 0.16
8 0.12
9 0.12
10 0.12
11 0.14
12 0.15
13 0.14
14 0.15
15 0.16
16 0.19
17 0.23
18 0.27
19 0.27
20 0.25
21 0.26
22 0.24
23 0.25
24 0.21
25 0.22
26 0.26
27 0.33
28 0.36
29 0.37
30 0.42
31 0.47
32 0.55
33 0.59
34 0.59
35 0.55
36 0.54
37 0.56
38 0.55
39 0.5
40 0.42
41 0.37
42 0.37
43 0.3
44 0.28
45 0.25
46 0.23
47 0.25
48 0.25
49 0.23
50 0.2
51 0.26
52 0.35
53 0.41
54 0.46
55 0.49
56 0.58
57 0.67
58 0.73
59 0.79
60 0.79
61 0.79
62 0.83
63 0.86
64 0.87
65 0.85
66 0.82
67 0.81
68 0.8
69 0.82
70 0.76
71 0.72
72 0.7
73 0.61
74 0.55
75 0.52
76 0.45
77 0.41
78 0.37
79 0.33