Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DRE2

Protein Details
Accession A0A371DRE2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-67QLPARRTVTSRCRSRRRRFPTGTTHHGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MRMHYSQRTVKASLSSVTAAGPARRSTRCRSSLELYPCRRQLPARRTVTSRCRSRRRRFPTGTTHHGTWVTPTVQTALPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.23
3 0.19
4 0.17
5 0.17
6 0.15
7 0.14
8 0.15
9 0.16
10 0.19
11 0.23
12 0.28
13 0.32
14 0.4
15 0.44
16 0.45
17 0.48
18 0.48
19 0.51
20 0.56
21 0.58
22 0.54
23 0.53
24 0.52
25 0.47
26 0.44
27 0.41
28 0.42
29 0.41
30 0.46
31 0.46
32 0.47
33 0.49
34 0.55
35 0.61
36 0.6
37 0.63
38 0.62
39 0.67
40 0.75
41 0.82
42 0.86
43 0.85
44 0.87
45 0.84
46 0.83
47 0.83
48 0.81
49 0.78
50 0.73
51 0.65
52 0.58
53 0.52
54 0.44
55 0.36
56 0.33
57 0.26
58 0.2
59 0.2
60 0.19