Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DC62

Protein Details
Accession A0A371DC62   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MHHLPQARRWPRPRPRPRGPKGSVAPBasic
NLS Segment(s)
PositionSequence
8-22RRWPRPRPRPRGPKG
Subcellular Location(s) mito 17.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
Amino Acid Sequences MHHLPQARRWPRPRPRPRGPKGSVAPSRCFRKLTLTGLQLPCCGLRLRRSCISQMAISGVHHQCISQRKARSRQPVLVNMCVNDSGIDSSGGSMVVAQQLEPCGADGQLTAPAAPSESAAIVASMQASCRLSLRGSHTSHGFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.9
4 0.91
5 0.91
6 0.85
7 0.84
8 0.79
9 0.79
10 0.76
11 0.69
12 0.67
13 0.64
14 0.66
15 0.59
16 0.54
17 0.45
18 0.45
19 0.46
20 0.45
21 0.44
22 0.41
23 0.47
24 0.48
25 0.47
26 0.39
27 0.34
28 0.28
29 0.23
30 0.2
31 0.15
32 0.21
33 0.26
34 0.32
35 0.36
36 0.38
37 0.39
38 0.41
39 0.41
40 0.33
41 0.28
42 0.23
43 0.19
44 0.17
45 0.21
46 0.17
47 0.15
48 0.14
49 0.14
50 0.16
51 0.22
52 0.25
53 0.25
54 0.31
55 0.37
56 0.45
57 0.52
58 0.58
59 0.55
60 0.59
61 0.57
62 0.6
63 0.56
64 0.53
65 0.46
66 0.37
67 0.33
68 0.26
69 0.22
70 0.14
71 0.1
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.06
78 0.05
79 0.05
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.07
88 0.07
89 0.07
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.09
96 0.09
97 0.08
98 0.08
99 0.08
100 0.08
101 0.08
102 0.08
103 0.06
104 0.06
105 0.07
106 0.07
107 0.07
108 0.06
109 0.06
110 0.07
111 0.06
112 0.06
113 0.09
114 0.1
115 0.1
116 0.12
117 0.13
118 0.13
119 0.18
120 0.25
121 0.31
122 0.33
123 0.37