Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DK88

Protein Details
Accession A0A371DK88    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-38PTSSSSSKAAKKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
14-32SSSKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MTRAKAKAAPTSSSSSKAAKKKKWSKGKVKDKAQHAVVLDKPTYDRILKEVPTFRFISQSILIERLKINGSLARVAIRHLEKEGQIKRIVHHSGQLIYTRSTGGGAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.42
4 0.48
5 0.53
6 0.55
7 0.64
8 0.7
9 0.78
10 0.83
11 0.86
12 0.88
13 0.89
14 0.92
15 0.91
16 0.91
17 0.88
18 0.83
19 0.8
20 0.7
21 0.63
22 0.52
23 0.47
24 0.39
25 0.35
26 0.28
27 0.22
28 0.2
29 0.18
30 0.2
31 0.16
32 0.13
33 0.13
34 0.17
35 0.18
36 0.21
37 0.26
38 0.25
39 0.27
40 0.28
41 0.25
42 0.24
43 0.23
44 0.22
45 0.18
46 0.18
47 0.15
48 0.18
49 0.17
50 0.16
51 0.16
52 0.14
53 0.14
54 0.12
55 0.13
56 0.11
57 0.12
58 0.12
59 0.13
60 0.13
61 0.12
62 0.13
63 0.17
64 0.17
65 0.17
66 0.18
67 0.2
68 0.21
69 0.3
70 0.33
71 0.32
72 0.35
73 0.35
74 0.35
75 0.4
76 0.42
77 0.34
78 0.35
79 0.34
80 0.31
81 0.33
82 0.35
83 0.29
84 0.27
85 0.26
86 0.22
87 0.19