Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DJ38

Protein Details
Accession A0A371DJ38   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
73-107KVKSQTPKVEKQEKKKTPKGRAKKRMLYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
73-98KVKSQTPKVEKQEKKKTPKGRAKKRM
Subcellular Location(s) mito 14, cyto 8.5, cyto_nucl 6.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MSGYAWALHVSAGAAFVLALRSYGALSEDVTCVLDTVVNIYRKMESLGYSRRAFEVARRNAVCVHGSLARAGKVKSQTPKVEKQEKKKTPKGRAKKRMLYNRRFVNVTTLPGGKRRMNPNPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.06
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.06
11 0.07
12 0.06
13 0.07
14 0.08
15 0.09
16 0.09
17 0.09
18 0.09
19 0.08
20 0.07
21 0.07
22 0.05
23 0.08
24 0.14
25 0.15
26 0.15
27 0.16
28 0.16
29 0.16
30 0.17
31 0.15
32 0.11
33 0.15
34 0.21
35 0.25
36 0.26
37 0.26
38 0.25
39 0.25
40 0.23
41 0.24
42 0.29
43 0.27
44 0.33
45 0.33
46 0.33
47 0.33
48 0.34
49 0.28
50 0.18
51 0.16
52 0.12
53 0.12
54 0.12
55 0.12
56 0.13
57 0.14
58 0.14
59 0.16
60 0.17
61 0.22
62 0.27
63 0.33
64 0.38
65 0.43
66 0.51
67 0.56
68 0.64
69 0.66
70 0.7
71 0.75
72 0.77
73 0.81
74 0.81
75 0.82
76 0.83
77 0.87
78 0.87
79 0.88
80 0.89
81 0.9
82 0.9
83 0.9
84 0.91
85 0.91
86 0.88
87 0.86
88 0.84
89 0.78
90 0.7
91 0.61
92 0.58
93 0.5
94 0.45
95 0.39
96 0.34
97 0.31
98 0.35
99 0.4
100 0.37
101 0.42
102 0.48
103 0.54