Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371D2M5

Protein Details
Accession A0A371D2M5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-76SGGPRPGITQHRRRRKRRSSIQVAVEEPHydrophilic
NLS Segment(s)
PositionSequence
53-66RPGITQHRRRRKRR
Subcellular Location(s) mito 21.5, cyto_mito 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MPPLASLNRRPPTRPRTSLTNVISLEFTADDFVEIDAMVLVAVHAGRSSGGPRPGITQHRRRRKRRSSIQVAVEEPTTLPIGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.61
3 0.62
4 0.65
5 0.7
6 0.63
7 0.6
8 0.5
9 0.44
10 0.4
11 0.31
12 0.25
13 0.16
14 0.13
15 0.07
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.04
22 0.04
23 0.03
24 0.03
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.03
34 0.03
35 0.05
36 0.09
37 0.11
38 0.12
39 0.13
40 0.16
41 0.22
42 0.3
43 0.37
44 0.44
45 0.52
46 0.63
47 0.73
48 0.8
49 0.85
50 0.87
51 0.91
52 0.91
53 0.92
54 0.91
55 0.9
56 0.88
57 0.82
58 0.73
59 0.64
60 0.53
61 0.42
62 0.32
63 0.25