Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371DHJ0

Protein Details
Accession A0A371DHJ0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-62LSAPRCVCRRRRPWPLHCAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, plas 5, extr 4, E.R. 2
Family & Domain DBs
Amino Acid Sequences MYVARRLCLPPPMPWICHPCSYARCARRGTACACACACCVPSLSAPRCVCRRRRPWPLHCAPAAIALSPLALRCSLVSRCMATRVGCCLLALLSLLCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.44
4 0.46
5 0.42
6 0.39
7 0.38
8 0.41
9 0.45
10 0.43
11 0.44
12 0.43
13 0.45
14 0.45
15 0.46
16 0.43
17 0.43
18 0.39
19 0.37
20 0.35
21 0.31
22 0.27
23 0.23
24 0.21
25 0.12
26 0.12
27 0.1
28 0.13
29 0.19
30 0.21
31 0.27
32 0.27
33 0.31
34 0.36
35 0.4
36 0.46
37 0.48
38 0.56
39 0.57
40 0.68
41 0.74
42 0.75
43 0.81
44 0.79
45 0.75
46 0.66
47 0.58
48 0.47
49 0.42
50 0.34
51 0.23
52 0.17
53 0.11
54 0.11
55 0.1
56 0.09
57 0.06
58 0.05
59 0.06
60 0.06
61 0.11
62 0.11
63 0.14
64 0.16
65 0.17
66 0.18
67 0.21
68 0.24
69 0.21
70 0.22
71 0.26
72 0.26
73 0.24
74 0.23
75 0.2
76 0.17
77 0.16
78 0.15