Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DES3

Protein Details
Accession A0A371DES3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-42TEGGIVKKKKKAKSTNKEKAAPPHydrophilic
NLS Segment(s)
PositionSequence
26-39KKKKKAKSTNKEKA
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MSSDYNFRPGGSLELKGGVTEGGIVKKKKKAKSTNKEKAAPPDEDRLKALERAIQDDEARAASPAGSGRNSPAIAGSSSDRKTAAEKRFEEVQRKRLAEKVARLANKSHKDRVNEFNTKLELLSEHHDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.18
5 0.12
6 0.09
7 0.09
8 0.1
9 0.13
10 0.19
11 0.22
12 0.27
13 0.34
14 0.42
15 0.48
16 0.56
17 0.62
18 0.68
19 0.77
20 0.83
21 0.86
22 0.87
23 0.86
24 0.79
25 0.78
26 0.72
27 0.65
28 0.57
29 0.55
30 0.5
31 0.45
32 0.42
33 0.35
34 0.31
35 0.28
36 0.25
37 0.19
38 0.16
39 0.19
40 0.19
41 0.18
42 0.16
43 0.15
44 0.15
45 0.12
46 0.12
47 0.08
48 0.07
49 0.05
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.1
57 0.1
58 0.1
59 0.09
60 0.09
61 0.08
62 0.09
63 0.1
64 0.13
65 0.14
66 0.15
67 0.14
68 0.14
69 0.18
70 0.25
71 0.31
72 0.34
73 0.34
74 0.38
75 0.45
76 0.49
77 0.54
78 0.52
79 0.53
80 0.52
81 0.53
82 0.51
83 0.47
84 0.51
85 0.47
86 0.47
87 0.48
88 0.47
89 0.48
90 0.49
91 0.49
92 0.52
93 0.56
94 0.55
95 0.55
96 0.53
97 0.57
98 0.61
99 0.64
100 0.64
101 0.62
102 0.59
103 0.56
104 0.52
105 0.47
106 0.41
107 0.33
108 0.25
109 0.2
110 0.23
111 0.21
112 0.22
113 0.23
114 0.25
115 0.24