Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1CXE3

Protein Details
Accession A1CXE3    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
116-139EEAATPTKPKRQRKTPVKKGAAAKHydrophilic
NLS Segment(s)
PositionSequence
92-102PKKGQAKRKKA
123-139KPKRQRKTPVKKGAAAK
Subcellular Location(s) cyto 18.5, cyto_nucl 13, nucl 6.5
Family & Domain DBs
KEGG nfi:NFIA_107870  -  
Amino Acid Sequences MASPAKAKPEGILGLSAGEAKILILGFLCITDQYKIDYEKLASKGGYTAGSANVMFNKAKRKLVELNPDNSTENGSSAAGESSSSKSATATPKKGQAKRKKAAAATGAEDGGADSEEAATPTKPKRQRKTPVKKGAAAKAGADSVENGNGASEVKPEPSKSEDIVKNEPMEEGNDDSELTVKAELDEVMNDADLDAELDALDAAQGAVKAEDHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.1
5 0.08
6 0.06
7 0.05
8 0.06
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.05
17 0.07
18 0.08
19 0.09
20 0.11
21 0.14
22 0.16
23 0.17
24 0.19
25 0.19
26 0.25
27 0.26
28 0.26
29 0.23
30 0.21
31 0.21
32 0.2
33 0.19
34 0.13
35 0.12
36 0.11
37 0.12
38 0.12
39 0.11
40 0.11
41 0.12
42 0.12
43 0.14
44 0.22
45 0.24
46 0.29
47 0.29
48 0.33
49 0.39
50 0.47
51 0.55
52 0.51
53 0.52
54 0.49
55 0.5
56 0.46
57 0.38
58 0.32
59 0.21
60 0.17
61 0.13
62 0.11
63 0.09
64 0.08
65 0.08
66 0.06
67 0.06
68 0.07
69 0.08
70 0.09
71 0.09
72 0.09
73 0.09
74 0.13
75 0.22
76 0.27
77 0.3
78 0.31
79 0.39
80 0.47
81 0.54
82 0.6
83 0.62
84 0.66
85 0.66
86 0.71
87 0.67
88 0.6
89 0.58
90 0.52
91 0.43
92 0.35
93 0.3
94 0.23
95 0.17
96 0.16
97 0.12
98 0.08
99 0.06
100 0.03
101 0.02
102 0.03
103 0.03
104 0.04
105 0.04
106 0.04
107 0.07
108 0.1
109 0.18
110 0.27
111 0.36
112 0.45
113 0.55
114 0.66
115 0.74
116 0.83
117 0.87
118 0.89
119 0.85
120 0.83
121 0.78
122 0.74
123 0.67
124 0.56
125 0.45
126 0.35
127 0.3
128 0.24
129 0.18
130 0.12
131 0.09
132 0.09
133 0.08
134 0.07
135 0.06
136 0.07
137 0.07
138 0.06
139 0.07
140 0.07
141 0.1
142 0.12
143 0.12
144 0.15
145 0.18
146 0.21
147 0.2
148 0.29
149 0.31
150 0.36
151 0.4
152 0.4
153 0.37
154 0.35
155 0.34
156 0.26
157 0.23
158 0.19
159 0.16
160 0.14
161 0.13
162 0.13
163 0.12
164 0.13
165 0.12
166 0.1
167 0.08
168 0.08
169 0.08
170 0.09
171 0.09
172 0.08
173 0.08
174 0.08
175 0.08
176 0.08
177 0.08
178 0.07
179 0.07
180 0.06
181 0.06
182 0.05
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.03
190 0.03
191 0.04
192 0.04
193 0.05
194 0.06
195 0.07