Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DGB4

Protein Details
Accession A0A371DGB4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
99-120PESAVRTKWEQRQERKAPRGYSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR005996  Ribosomal_L30_bac-type  
IPR016082  Ribosomal_L30_ferredoxin-like  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
CDD cd01658  Ribosomal_L30  
Amino Acid Sequences MFTAAASLRSCASSSAKAQCRSLATSAASSTAQSSTSEPLTHYRITLRRSAISLPQNIKGTLEALGIHRRLQTVYHRHTPDIAGKILTVKELVTVENVPESAVRTKWEQRQERKAPRGYSVTGSKLQVDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.33
3 0.4
4 0.42
5 0.43
6 0.44
7 0.43
8 0.42
9 0.39
10 0.33
11 0.27
12 0.25
13 0.24
14 0.22
15 0.19
16 0.15
17 0.15
18 0.12
19 0.11
20 0.1
21 0.11
22 0.12
23 0.13
24 0.13
25 0.13
26 0.16
27 0.19
28 0.18
29 0.18
30 0.21
31 0.24
32 0.26
33 0.3
34 0.29
35 0.27
36 0.28
37 0.29
38 0.3
39 0.3
40 0.33
41 0.3
42 0.32
43 0.32
44 0.3
45 0.29
46 0.22
47 0.18
48 0.13
49 0.11
50 0.08
51 0.08
52 0.11
53 0.12
54 0.12
55 0.12
56 0.12
57 0.12
58 0.13
59 0.2
60 0.25
61 0.3
62 0.38
63 0.38
64 0.38
65 0.39
66 0.39
67 0.37
68 0.31
69 0.26
70 0.18
71 0.17
72 0.19
73 0.18
74 0.16
75 0.11
76 0.08
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.09
83 0.1
84 0.1
85 0.08
86 0.08
87 0.11
88 0.11
89 0.12
90 0.14
91 0.18
92 0.25
93 0.33
94 0.43
95 0.5
96 0.57
97 0.67
98 0.76
99 0.81
100 0.83
101 0.84
102 0.77
103 0.74
104 0.7
105 0.62
106 0.58
107 0.53
108 0.49
109 0.45
110 0.44