Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CGP1

Protein Details
Accession A0A371CGP1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
14-42LKRKASSIANHVKKKRKKGKGPGSDTESGBasic
NLS Segment(s)
PositionSequence
16-35RKASSIANHVKKKRKKGKGP
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MLSPKQVKNVFEMLKRKASSIANHVKKKRKKGKGPGSDTESGSHISISSKSSKSSYHSPTVEDAEDEDDVRKSQAATEGVEDLAEAPPVKKKKPLMPEQDLANKQKRWKSPVYAFYKEKVMIVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.49
4 0.46
5 0.45
6 0.42
7 0.45
8 0.5
9 0.51
10 0.6
11 0.67
12 0.72
13 0.75
14 0.82
15 0.82
16 0.82
17 0.83
18 0.86
19 0.89
20 0.89
21 0.89
22 0.85
23 0.82
24 0.75
25 0.65
26 0.55
27 0.45
28 0.35
29 0.27
30 0.2
31 0.13
32 0.1
33 0.1
34 0.11
35 0.14
36 0.14
37 0.15
38 0.16
39 0.18
40 0.21
41 0.28
42 0.3
43 0.32
44 0.32
45 0.32
46 0.32
47 0.33
48 0.29
49 0.21
50 0.17
51 0.12
52 0.11
53 0.1
54 0.09
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.11
62 0.11
63 0.12
64 0.13
65 0.13
66 0.13
67 0.13
68 0.12
69 0.08
70 0.07
71 0.07
72 0.06
73 0.06
74 0.12
75 0.16
76 0.18
77 0.23
78 0.28
79 0.36
80 0.45
81 0.55
82 0.58
83 0.62
84 0.64
85 0.64
86 0.68
87 0.65
88 0.62
89 0.6
90 0.54
91 0.54
92 0.58
93 0.59
94 0.57
95 0.59
96 0.63
97 0.64
98 0.7
99 0.72
100 0.73
101 0.69
102 0.65
103 0.63
104 0.54