Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371DCP9

Protein Details
Accession A0A371DCP9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
68-87GGKHCDRKVKIKNTKNGKTABasic
NLS Segment(s)
Subcellular Location(s) extr 24, E.R. 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009009  RlpA-like_DPBB  
IPR036908  RlpA-like_sf  
Pfam View protein in Pfam  
PF03330  DPBB_1  
CDD cd22191  DPBB_RlpA_EXP_N-like  
Amino Acid Sequences MSRIAFIAFLFALIVAVVAAPSGTPEGTIEKRSRTGRGTWFNVGLGACGKTNKDSDKIIAISSKIYGGGKHCDRKVKIKNTKNGKTATAKVRDECPGCGANDIDMSPSLFKQLGSLDEGVLKVSWDFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.02
8 0.03
9 0.04
10 0.04
11 0.04
12 0.05
13 0.11
14 0.13
15 0.18
16 0.2
17 0.22
18 0.28
19 0.31
20 0.34
21 0.32
22 0.36
23 0.4
24 0.46
25 0.48
26 0.45
27 0.43
28 0.39
29 0.38
30 0.31
31 0.23
32 0.16
33 0.12
34 0.09
35 0.09
36 0.1
37 0.1
38 0.13
39 0.14
40 0.16
41 0.16
42 0.17
43 0.19
44 0.19
45 0.18
46 0.16
47 0.15
48 0.12
49 0.11
50 0.1
51 0.08
52 0.07
53 0.08
54 0.09
55 0.15
56 0.2
57 0.25
58 0.27
59 0.33
60 0.35
61 0.44
62 0.52
63 0.56
64 0.62
65 0.65
66 0.71
67 0.75
68 0.8
69 0.76
70 0.69
71 0.63
72 0.58
73 0.57
74 0.56
75 0.54
76 0.49
77 0.45
78 0.46
79 0.47
80 0.43
81 0.37
82 0.33
83 0.27
84 0.25
85 0.25
86 0.21
87 0.17
88 0.16
89 0.15
90 0.13
91 0.11
92 0.11
93 0.11
94 0.1
95 0.12
96 0.11
97 0.11
98 0.11
99 0.13
100 0.13
101 0.16
102 0.17
103 0.15
104 0.16
105 0.16
106 0.16
107 0.14
108 0.13