Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371DH91

Protein Details
Accession A0A371DH91    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
108-132DTRRQGNDKKAPYRRAIRRNRSMRTHydrophilic
NLS Segment(s)
PositionSequence
116-128KKAPYRRAIRRNR
Subcellular Location(s) mito 8extr 8, plas 6, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MGAIFSAIGGAINAVVSAIANHRHYLRRHLRHPLLQLLRRTHPSHGNAQIQIRQWGRRDILSCYRRRPRSMRRDIYPPPLYHHLDDAFYNAVLYPYWREHGVHIVAIDTRRQGNDKKAPYRRAIRRNRSMRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.06
6 0.11
7 0.12
8 0.14
9 0.18
10 0.24
11 0.26
12 0.36
13 0.44
14 0.49
15 0.54
16 0.63
17 0.66
18 0.66
19 0.69
20 0.68
21 0.66
22 0.62
23 0.62
24 0.57
25 0.55
26 0.54
27 0.51
28 0.45
29 0.44
30 0.42
31 0.43
32 0.45
33 0.45
34 0.42
35 0.42
36 0.42
37 0.36
38 0.39
39 0.34
40 0.3
41 0.28
42 0.29
43 0.28
44 0.27
45 0.27
46 0.26
47 0.34
48 0.38
49 0.4
50 0.44
51 0.51
52 0.52
53 0.56
54 0.6
55 0.6
56 0.64
57 0.71
58 0.7
59 0.65
60 0.7
61 0.69
62 0.69
63 0.64
64 0.53
65 0.47
66 0.46
67 0.44
68 0.37
69 0.36
70 0.27
71 0.23
72 0.23
73 0.19
74 0.14
75 0.12
76 0.11
77 0.08
78 0.08
79 0.07
80 0.08
81 0.09
82 0.1
83 0.11
84 0.12
85 0.13
86 0.14
87 0.2
88 0.2
89 0.18
90 0.17
91 0.16
92 0.18
93 0.18
94 0.18
95 0.15
96 0.15
97 0.16
98 0.2
99 0.24
100 0.31
101 0.4
102 0.48
103 0.56
104 0.63
105 0.68
106 0.73
107 0.79
108 0.8
109 0.81
110 0.83
111 0.83
112 0.85