Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DP54

Protein Details
Accession A0A371DP54    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
139-161FYCSRPCQASDWKRHKKYCRQVAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 7, mito 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF13424  TPR_12  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS50005  TPR  
PS50865  ZF_MYND_2  
Amino Acid Sequences LHNEASRLKSAGDLEGAERMYLQAIADKEASLGTDHFVTATSYDGLGEVYLAMQRPAKAEEYFNKALHVRERSGFACDLAMTRDNLGQVYEMKGDLRAAQEMRLRGAADSNIACGNYNCLKLQNNLSDLSRCSVCKAVFYCSRPCQASDWKRHKKYCRQVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.18
4 0.15
5 0.14
6 0.12
7 0.11
8 0.1
9 0.09
10 0.1
11 0.1
12 0.12
13 0.13
14 0.13
15 0.12
16 0.12
17 0.12
18 0.09
19 0.09
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.07
27 0.08
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.05
35 0.04
36 0.04
37 0.05
38 0.05
39 0.06
40 0.07
41 0.08
42 0.09
43 0.11
44 0.13
45 0.13
46 0.17
47 0.2
48 0.27
49 0.3
50 0.29
51 0.29
52 0.27
53 0.28
54 0.3
55 0.29
56 0.23
57 0.2
58 0.23
59 0.22
60 0.24
61 0.22
62 0.17
63 0.14
64 0.12
65 0.11
66 0.09
67 0.1
68 0.07
69 0.08
70 0.08
71 0.08
72 0.08
73 0.08
74 0.07
75 0.07
76 0.08
77 0.08
78 0.07
79 0.07
80 0.07
81 0.08
82 0.08
83 0.08
84 0.1
85 0.09
86 0.13
87 0.16
88 0.16
89 0.17
90 0.17
91 0.16
92 0.14
93 0.15
94 0.12
95 0.11
96 0.11
97 0.11
98 0.11
99 0.1
100 0.11
101 0.09
102 0.14
103 0.15
104 0.16
105 0.16
106 0.18
107 0.2
108 0.23
109 0.29
110 0.29
111 0.28
112 0.28
113 0.29
114 0.28
115 0.28
116 0.28
117 0.24
118 0.2
119 0.2
120 0.24
121 0.22
122 0.26
123 0.26
124 0.3
125 0.35
126 0.39
127 0.45
128 0.44
129 0.51
130 0.47
131 0.47
132 0.46
133 0.49
134 0.55
135 0.58
136 0.64
137 0.69
138 0.76
139 0.84
140 0.88
141 0.89