Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1D3J1

Protein Details
Accession A1D3J1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-78LRAVPKKKTSHMKKRHRQMAGKABasic
NLS Segment(s)
PositionSequence
60-76PKKKTSHMKKRHRQMAG
Subcellular Location(s) mito 22, nucl 3.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nfi:NFIA_016800  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MFPRVLLSSEPLSPSAAGRWSRSLQSSPILPHRLLRPAALSLNLPGIFSGIWDSVLRAVPKKKTSHMKKRHRQMAGKALKDLKNLNTCSGCGRMKRAHVLCPHCVEDIKKQWKHTQTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.2
4 0.2
5 0.21
6 0.25
7 0.27
8 0.29
9 0.32
10 0.31
11 0.28
12 0.29
13 0.29
14 0.28
15 0.33
16 0.34
17 0.31
18 0.32
19 0.33
20 0.35
21 0.32
22 0.29
23 0.24
24 0.23
25 0.23
26 0.21
27 0.18
28 0.13
29 0.16
30 0.15
31 0.12
32 0.1
33 0.09
34 0.08
35 0.08
36 0.08
37 0.05
38 0.06
39 0.06
40 0.06
41 0.07
42 0.1
43 0.1
44 0.12
45 0.15
46 0.19
47 0.24
48 0.26
49 0.31
50 0.4
51 0.5
52 0.58
53 0.65
54 0.72
55 0.76
56 0.84
57 0.87
58 0.84
59 0.8
60 0.76
61 0.76
62 0.74
63 0.66
64 0.6
65 0.58
66 0.52
67 0.49
68 0.44
69 0.39
70 0.38
71 0.38
72 0.38
73 0.33
74 0.31
75 0.31
76 0.34
77 0.31
78 0.26
79 0.31
80 0.32
81 0.35
82 0.45
83 0.45
84 0.46
85 0.51
86 0.54
87 0.54
88 0.54
89 0.52
90 0.44
91 0.44
92 0.4
93 0.41
94 0.46
95 0.51
96 0.5
97 0.53
98 0.61