Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371DTN0

Protein Details
Accession A0A371DTN0    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-30LAVPKKKTSHSRKAMRSANKHydrophilic
NLS Segment(s)
PositionSequence
16-24KKTSHSRKA
Subcellular Location(s) mito 21, nucl 3, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences SLLELFPSWLLAVPKKKTSHSRKAMRSANKGLKDKQNLVHCPACGSPKLAHNLCPTCYRELNVGWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.44
4 0.52
5 0.59
6 0.63
7 0.66
8 0.71
9 0.72
10 0.78
11 0.81
12 0.78
13 0.76
14 0.74
15 0.71
16 0.69
17 0.65
18 0.6
19 0.59
20 0.56
21 0.52
22 0.49
23 0.49
24 0.44
25 0.45
26 0.44
27 0.36
28 0.34
29 0.32
30 0.29
31 0.22
32 0.23
33 0.2
34 0.22
35 0.3
36 0.29
37 0.33
38 0.38
39 0.4
40 0.4
41 0.43
42 0.41
43 0.4
44 0.41
45 0.37
46 0.34