Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CPZ6

Protein Details
Accession A0A371CPZ6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
95-117YLSSSARRQARNRTPCRRPEVGWHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 11, cyto 2
Family & Domain DBs
Amino Acid Sequences MYRKRRRSVPFQCLYSCFGVFARTPAYFGGVFAKSIVDGSVRRPVLSPPSPIHSCRGASSTRRSLAWGLHSCAPYFSGSSNHVELCCVAANVVGYLSSSARRQARNRTPCRRPEVGWRGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.54
3 0.43
4 0.34
5 0.25
6 0.23
7 0.19
8 0.18
9 0.18
10 0.15
11 0.15
12 0.14
13 0.17
14 0.14
15 0.14
16 0.17
17 0.14
18 0.14
19 0.13
20 0.13
21 0.1
22 0.1
23 0.1
24 0.07
25 0.07
26 0.1
27 0.17
28 0.17
29 0.18
30 0.18
31 0.19
32 0.25
33 0.27
34 0.29
35 0.23
36 0.29
37 0.31
38 0.31
39 0.33
40 0.28
41 0.26
42 0.23
43 0.23
44 0.2
45 0.21
46 0.26
47 0.28
48 0.27
49 0.26
50 0.26
51 0.25
52 0.24
53 0.28
54 0.25
55 0.23
56 0.25
57 0.26
58 0.24
59 0.23
60 0.23
61 0.16
62 0.13
63 0.12
64 0.1
65 0.12
66 0.15
67 0.16
68 0.16
69 0.15
70 0.15
71 0.14
72 0.13
73 0.11
74 0.08
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.05
81 0.05
82 0.06
83 0.07
84 0.08
85 0.09
86 0.15
87 0.21
88 0.28
89 0.34
90 0.44
91 0.54
92 0.63
93 0.73
94 0.77
95 0.81
96 0.83
97 0.86
98 0.8
99 0.73
100 0.73