Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CXK6

Protein Details
Accession A0A371CXK6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-28RRTVRGARIRADRHRRLRSPQASRCBasic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 10, cyto_nucl 7.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSVRRTVRGARIRADRHRRLRSPQASRCAWCLSQRTSQRPADLSRGQSAGLSAEQRDSAITVVVYLLHHIYTTWHPSRHRHRSMTSVNPKLGNSSERFPRTQSTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.76
4 0.82
5 0.8
6 0.79
7 0.82
8 0.81
9 0.81
10 0.79
11 0.77
12 0.72
13 0.68
14 0.63
15 0.56
16 0.48
17 0.43
18 0.4
19 0.36
20 0.4
21 0.45
22 0.48
23 0.5
24 0.5
25 0.47
26 0.45
27 0.43
28 0.41
29 0.38
30 0.34
31 0.3
32 0.28
33 0.25
34 0.22
35 0.2
36 0.13
37 0.11
38 0.09
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.07
58 0.1
59 0.17
60 0.2
61 0.24
62 0.28
63 0.37
64 0.48
65 0.56
66 0.61
67 0.6
68 0.6
69 0.65
70 0.7
71 0.72
72 0.71
73 0.67
74 0.63
75 0.59
76 0.56
77 0.5
78 0.45
79 0.4
80 0.33
81 0.33
82 0.39
83 0.41
84 0.42
85 0.41