Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371D1W5

Protein Details
Accession A0A371D1W5   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
44-69SSSPYGRTHVWKRRPKRMPNPVVPVFHydrophilic
NLS Segment(s)
PositionSequence
163-168KAKGKK
Subcellular Location(s) mito 19.5, cyto_mito 11, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MSLLSMLPSTSRVACASALGSTKTTLPSSSLPLFHHQTQTRSVSSSPYGRTHVWKRRPKRMPNPVVPVFPQRLVRVDGSTIIHYTTSPRSVIKLTRDTTNNPIWNAARFVGMDEEEDEVTGRLGRFSRRFADLGGEGEKTDMEWMNEASGTEEAKHSNAGEGKAKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.14
5 0.15
6 0.15
7 0.15
8 0.14
9 0.16
10 0.17
11 0.17
12 0.15
13 0.16
14 0.17
15 0.22
16 0.24
17 0.25
18 0.25
19 0.3
20 0.34
21 0.34
22 0.4
23 0.37
24 0.37
25 0.4
26 0.41
27 0.37
28 0.34
29 0.32
30 0.27
31 0.27
32 0.3
33 0.27
34 0.26
35 0.29
36 0.29
37 0.35
38 0.42
39 0.48
40 0.54
41 0.6
42 0.65
43 0.72
44 0.81
45 0.84
46 0.85
47 0.86
48 0.85
49 0.84
50 0.85
51 0.77
52 0.69
53 0.61
54 0.54
55 0.45
56 0.37
57 0.31
58 0.24
59 0.22
60 0.23
61 0.22
62 0.18
63 0.16
64 0.16
65 0.14
66 0.14
67 0.12
68 0.1
69 0.09
70 0.08
71 0.1
72 0.09
73 0.1
74 0.1
75 0.1
76 0.11
77 0.13
78 0.17
79 0.2
80 0.25
81 0.25
82 0.3
83 0.32
84 0.33
85 0.36
86 0.4
87 0.37
88 0.31
89 0.32
90 0.28
91 0.27
92 0.26
93 0.21
94 0.15
95 0.12
96 0.13
97 0.11
98 0.11
99 0.1
100 0.09
101 0.1
102 0.09
103 0.09
104 0.08
105 0.07
106 0.07
107 0.08
108 0.07
109 0.08
110 0.1
111 0.16
112 0.18
113 0.22
114 0.25
115 0.27
116 0.28
117 0.27
118 0.3
119 0.26
120 0.26
121 0.24
122 0.21
123 0.17
124 0.17
125 0.16
126 0.11
127 0.12
128 0.11
129 0.09
130 0.1
131 0.11
132 0.12
133 0.12
134 0.12
135 0.12
136 0.12
137 0.12
138 0.11
139 0.12
140 0.13
141 0.13
142 0.15
143 0.13
144 0.18
145 0.2
146 0.23
147 0.28
148 0.3