Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CWH8

Protein Details
Accession A0A371CWH8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-46LDCWTRSGTRVPRRRRCRRRARAATSRTQAHydrophilic
NLS Segment(s)
PositionSequence
27-38VPRRRRCRRRAR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MIDSEWCRPELRRPSSLDCWTRSGTRVPRRRRCRRRARAATSRTQATANTAQHRDGGHESATSDALVSMYATLPGSADARLMQPAPPPCRML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.68
4 0.64
5 0.56
6 0.54
7 0.51
8 0.47
9 0.41
10 0.41
11 0.42
12 0.47
13 0.53
14 0.59
15 0.67
16 0.76
17 0.86
18 0.89
19 0.9
20 0.92
21 0.93
22 0.94
23 0.94
24 0.92
25 0.91
26 0.86
27 0.83
28 0.75
29 0.66
30 0.55
31 0.45
32 0.36
33 0.3
34 0.3
35 0.25
36 0.25
37 0.25
38 0.24
39 0.26
40 0.26
41 0.24
42 0.2
43 0.19
44 0.14
45 0.14
46 0.14
47 0.13
48 0.13
49 0.1
50 0.08
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.04
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.07
63 0.07
64 0.07
65 0.08
66 0.09
67 0.11
68 0.12
69 0.12
70 0.18
71 0.26
72 0.3