Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371DQU7

Protein Details
Accession A0A371DQU7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
25-48ISVTASRRYKRRARRTRNNIVVSSHydrophilic
NLS Segment(s)
PositionSequence
34-38KRRAR
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 9, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MKDRSSSSTRVVQDLQDMYQNPELISVTASRRYKRRARRTRNNIVVSSEAFGAMGTYRIPGGARDDTGMREYALGPTDRIGERPPMHPIIEPRAPASEGHLLPRLEVPKTDPAPAVQNTIAWQLAQLSIPQEVPEESAALPEGSDDEPLCPGPSSAVPVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.28
4 0.27
5 0.27
6 0.29
7 0.28
8 0.22
9 0.21
10 0.21
11 0.16
12 0.16
13 0.14
14 0.14
15 0.21
16 0.25
17 0.28
18 0.34
19 0.42
20 0.51
21 0.59
22 0.68
23 0.71
24 0.78
25 0.85
26 0.89
27 0.92
28 0.93
29 0.87
30 0.78
31 0.7
32 0.61
33 0.5
34 0.41
35 0.3
36 0.2
37 0.14
38 0.11
39 0.08
40 0.06
41 0.06
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.1
49 0.1
50 0.11
51 0.11
52 0.12
53 0.13
54 0.14
55 0.14
56 0.09
57 0.09
58 0.09
59 0.09
60 0.1
61 0.09
62 0.08
63 0.08
64 0.11
65 0.1
66 0.1
67 0.1
68 0.14
69 0.16
70 0.17
71 0.2
72 0.19
73 0.2
74 0.21
75 0.22
76 0.23
77 0.24
78 0.23
79 0.2
80 0.2
81 0.2
82 0.18
83 0.2
84 0.2
85 0.17
86 0.19
87 0.23
88 0.22
89 0.22
90 0.25
91 0.23
92 0.17
93 0.17
94 0.19
95 0.22
96 0.24
97 0.25
98 0.22
99 0.22
100 0.27
101 0.27
102 0.27
103 0.19
104 0.18
105 0.18
106 0.19
107 0.18
108 0.12
109 0.12
110 0.09
111 0.1
112 0.1
113 0.09
114 0.08
115 0.09
116 0.1
117 0.1
118 0.1
119 0.09
120 0.11
121 0.1
122 0.11
123 0.09
124 0.1
125 0.1
126 0.09
127 0.09
128 0.07
129 0.09
130 0.08
131 0.1
132 0.09
133 0.09
134 0.11
135 0.12
136 0.14
137 0.12
138 0.11
139 0.13
140 0.14
141 0.18