Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371CKI1

Protein Details
Accession A0A371CKI1   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
124-149GSASNSSNAKKRKRAKRKESPTSPSPHydrophilic
NLS Segment(s)
PositionSequence
132-143AKKRKRAKRKES
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MILTASRRIDKLPATGQYVLDQFKAQTTWVGSLFMGGPNPETGKLTTLTVHTGKTLNLNNEFPKATALWKDVESAWERYVTACFAPDTAEKLHEAYHKLTPEADRLISSSPSTTSSPSPPPPDGSASNSSNAKKRKRAKRKESPTSPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.37
4 0.35
5 0.36
6 0.31
7 0.25
8 0.22
9 0.17
10 0.17
11 0.16
12 0.14
13 0.13
14 0.14
15 0.15
16 0.15
17 0.16
18 0.14
19 0.14
20 0.14
21 0.12
22 0.11
23 0.09
24 0.09
25 0.09
26 0.11
27 0.1
28 0.11
29 0.11
30 0.12
31 0.13
32 0.13
33 0.12
34 0.12
35 0.16
36 0.15
37 0.15
38 0.14
39 0.14
40 0.14
41 0.18
42 0.2
43 0.2
44 0.22
45 0.24
46 0.24
47 0.25
48 0.25
49 0.2
50 0.18
51 0.15
52 0.13
53 0.13
54 0.13
55 0.12
56 0.12
57 0.13
58 0.12
59 0.14
60 0.15
61 0.15
62 0.14
63 0.13
64 0.13
65 0.12
66 0.12
67 0.11
68 0.08
69 0.07
70 0.07
71 0.06
72 0.08
73 0.08
74 0.1
75 0.1
76 0.11
77 0.11
78 0.11
79 0.14
80 0.15
81 0.17
82 0.17
83 0.2
84 0.2
85 0.2
86 0.22
87 0.21
88 0.21
89 0.21
90 0.19
91 0.15
92 0.15
93 0.17
94 0.16
95 0.15
96 0.13
97 0.12
98 0.14
99 0.15
100 0.16
101 0.17
102 0.2
103 0.25
104 0.3
105 0.34
106 0.33
107 0.36
108 0.36
109 0.38
110 0.37
111 0.37
112 0.37
113 0.34
114 0.36
115 0.38
116 0.38
117 0.41
118 0.47
119 0.5
120 0.53
121 0.62
122 0.69
123 0.76
124 0.84
125 0.88
126 0.91
127 0.93
128 0.95
129 0.95