Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371DBZ6

Protein Details
Accession A0A371DBZ6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-43YRCCSAGRLTRRRVNHKYRWRRFRPYRVFRKFRNGSHydrophilic
NLS Segment(s)
PositionSequence
19-32RRVNHKYRWRRFRP
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MATSRGQYRCCSAGRLTRRRVNHKYRWRRFRPYRVFRKFRNGSAMLILKMPIGTPLGTFNSDCTRSRLSETSEASTATSYVYPGISAALTTAQGSSVSAESNNVDTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.55
3 0.59
4 0.62
5 0.69
6 0.75
7 0.8
8 0.8
9 0.8
10 0.82
11 0.85
12 0.88
13 0.91
14 0.89
15 0.9
16 0.9
17 0.9
18 0.9
19 0.9
20 0.9
21 0.9
22 0.89
23 0.82
24 0.83
25 0.76
26 0.68
27 0.65
28 0.55
29 0.45
30 0.43
31 0.4
32 0.29
33 0.25
34 0.22
35 0.14
36 0.12
37 0.11
38 0.07
39 0.06
40 0.05
41 0.05
42 0.07
43 0.08
44 0.09
45 0.09
46 0.1
47 0.13
48 0.16
49 0.16
50 0.19
51 0.2
52 0.2
53 0.24
54 0.25
55 0.26
56 0.3
57 0.31
58 0.3
59 0.28
60 0.28
61 0.24
62 0.22
63 0.17
64 0.12
65 0.09
66 0.07
67 0.07
68 0.07
69 0.06
70 0.06
71 0.07
72 0.05
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.07
82 0.08
83 0.08
84 0.08
85 0.08
86 0.1
87 0.11