Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371CHK7

Protein Details
Accession A0A371CHK7    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-33YCSSADARRRKRRAIEPPDDHydrophilic
NLS Segment(s)
PositionSequence
22-25RRKR
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MPALWSPGLELVLYCSSADARRRKRRAIEPPDDVESEAVSLSAECLRPSPDGRRRRAHVRYSTEHELGSSRLQLRPSSQLQCSPSTFTLARRSQTVDPAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.11
4 0.16
5 0.23
6 0.29
7 0.39
8 0.5
9 0.56
10 0.63
11 0.71
12 0.76
13 0.8
14 0.8
15 0.78
16 0.74
17 0.72
18 0.68
19 0.59
20 0.49
21 0.38
22 0.28
23 0.19
24 0.13
25 0.08
26 0.05
27 0.04
28 0.04
29 0.06
30 0.06
31 0.06
32 0.07
33 0.08
34 0.1
35 0.12
36 0.2
37 0.28
38 0.36
39 0.42
40 0.48
41 0.51
42 0.59
43 0.64
44 0.64
45 0.64
46 0.63
47 0.63
48 0.64
49 0.65
50 0.56
51 0.48
52 0.4
53 0.32
54 0.26
55 0.22
56 0.19
57 0.15
58 0.17
59 0.19
60 0.19
61 0.21
62 0.26
63 0.3
64 0.31
65 0.32
66 0.35
67 0.37
68 0.4
69 0.39
70 0.37
71 0.32
72 0.33
73 0.32
74 0.31
75 0.37
76 0.38
77 0.38
78 0.36
79 0.41
80 0.39