Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A371D5K6

Protein Details
Accession A0A371D5K6   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
145-168LGRCLPPRRADDRRRERRLCQRDGBasic
NLS Segment(s)
PositionSequence
125-141RRAKAYAAAARRSRLKA
151-161PRRADDRRRER
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVYDSEHVRLHYQPPEPRNGVRIVSRTKRHDLRVTAPVRPPPDSRLYILHRIPRLCTPCKFPSPPLPSPVLSSNFEASQSSLTLTCTRPRPLGAHEDDDIHTGLGASDTHAPTPEAQSCLPFLRRRAKAYAAAARRSRLKAEVGLGRCLPPRRADDRRRERRLCQRDGQRVQAKRSRLLPLLRWRPAGYDNPRHIVVDAESTSSASLSKDPLPPIAAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.53
4 0.52
5 0.51
6 0.47
7 0.44
8 0.41
9 0.44
10 0.44
11 0.49
12 0.55
13 0.58
14 0.63
15 0.67
16 0.68
17 0.69
18 0.66
19 0.63
20 0.65
21 0.62
22 0.59
23 0.57
24 0.56
25 0.51
26 0.49
27 0.45
28 0.4
29 0.44
30 0.4
31 0.38
32 0.39
33 0.41
34 0.45
35 0.47
36 0.49
37 0.46
38 0.45
39 0.45
40 0.45
41 0.46
42 0.44
43 0.42
44 0.43
45 0.45
46 0.52
47 0.52
48 0.49
49 0.53
50 0.55
51 0.56
52 0.52
53 0.49
54 0.42
55 0.42
56 0.42
57 0.35
58 0.29
59 0.27
60 0.25
61 0.22
62 0.22
63 0.19
64 0.15
65 0.12
66 0.1
67 0.09
68 0.08
69 0.09
70 0.11
71 0.12
72 0.16
73 0.19
74 0.21
75 0.21
76 0.23
77 0.24
78 0.24
79 0.3
80 0.29
81 0.28
82 0.26
83 0.27
84 0.26
85 0.25
86 0.22
87 0.14
88 0.1
89 0.07
90 0.07
91 0.05
92 0.05
93 0.04
94 0.07
95 0.08
96 0.08
97 0.08
98 0.09
99 0.09
100 0.11
101 0.12
102 0.11
103 0.11
104 0.12
105 0.13
106 0.15
107 0.18
108 0.18
109 0.22
110 0.29
111 0.32
112 0.35
113 0.37
114 0.39
115 0.4
116 0.43
117 0.46
118 0.41
119 0.44
120 0.42
121 0.41
122 0.42
123 0.39
124 0.35
125 0.29
126 0.27
127 0.23
128 0.25
129 0.29
130 0.27
131 0.28
132 0.27
133 0.27
134 0.29
135 0.29
136 0.26
137 0.24
138 0.28
139 0.34
140 0.44
141 0.51
142 0.58
143 0.67
144 0.76
145 0.82
146 0.8
147 0.81
148 0.82
149 0.82
150 0.79
151 0.76
152 0.76
153 0.77
154 0.76
155 0.78
156 0.75
157 0.71
158 0.72
159 0.68
160 0.62
161 0.56
162 0.57
163 0.53
164 0.5
165 0.49
166 0.5
167 0.55
168 0.61
169 0.6
170 0.58
171 0.53
172 0.5
173 0.5
174 0.51
175 0.49
176 0.49
177 0.5
178 0.51
179 0.52
180 0.49
181 0.45
182 0.38
183 0.3
184 0.26
185 0.22
186 0.2
187 0.19
188 0.18
189 0.18
190 0.16
191 0.15
192 0.1
193 0.11
194 0.12
195 0.16
196 0.21
197 0.22
198 0.25
199 0.26