Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L842

Protein Details
Accession E2L842   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MLKRVKSRKRWHTNSNAISSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038013  ALG11  
IPR031814  ALG11_N  
Gene Ontology GO:0004377  F:GDP-Man:Man3GlcNAc2-PP-Dol alpha-1,2-mannosyltransferase activity  
KEGG mpr:MPER_02085  -  
Pfam View protein in Pfam  
PF15924  ALG11_N  
Amino Acid Sequences MLKRVKSRKRWHTNSNAISSSSILSAAKLFYYRLFMYYYSLSLRSAVQNKKQVSNSRIVYPPCDTREMATIPLEGRERTIISVAQFRFEVFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.82
3 0.72
4 0.62
5 0.54
6 0.45
7 0.35
8 0.24
9 0.18
10 0.11
11 0.09
12 0.09
13 0.08
14 0.08
15 0.08
16 0.08
17 0.08
18 0.12
19 0.12
20 0.12
21 0.13
22 0.13
23 0.15
24 0.15
25 0.15
26 0.12
27 0.13
28 0.12
29 0.11
30 0.12
31 0.13
32 0.19
33 0.22
34 0.27
35 0.33
36 0.34
37 0.39
38 0.43
39 0.46
40 0.42
41 0.45
42 0.42
43 0.39
44 0.42
45 0.38
46 0.36
47 0.33
48 0.36
49 0.31
50 0.32
51 0.28
52 0.25
53 0.28
54 0.27
55 0.25
56 0.21
57 0.19
58 0.17
59 0.2
60 0.21
61 0.16
62 0.16
63 0.17
64 0.16
65 0.16
66 0.18
67 0.16
68 0.17
69 0.24
70 0.23
71 0.23
72 0.23