Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A371D487

Protein Details
Accession A0A371D487    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
73-94QAARAKREKAKERKKAHMPPGPBasic
NLS Segment(s)
PositionSequence
56-92ASKSRERLERAKAAVAAQAARAKREKAKERKKAHMPP
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MARQGKKKVFVNDKDAAIDLARSISDIAEEKAQTKIKMHHSKASAGANLGHQRPTASKSRERLERAKAAVAAQAARAKREKAKERKKAHMPPGPSRQTQPGDATQTESGGRPPDDSAKPRKRVTFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.4
4 0.3
5 0.23
6 0.15
7 0.11
8 0.09
9 0.08
10 0.07
11 0.06
12 0.07
13 0.08
14 0.09
15 0.12
16 0.13
17 0.13
18 0.18
19 0.21
20 0.2
21 0.22
22 0.28
23 0.35
24 0.45
25 0.47
26 0.48
27 0.47
28 0.49
29 0.5
30 0.47
31 0.37
32 0.28
33 0.26
34 0.23
35 0.25
36 0.23
37 0.19
38 0.16
39 0.16
40 0.17
41 0.19
42 0.23
43 0.24
44 0.28
45 0.32
46 0.38
47 0.44
48 0.47
49 0.49
50 0.47
51 0.47
52 0.43
53 0.4
54 0.35
55 0.29
56 0.26
57 0.21
58 0.16
59 0.12
60 0.14
61 0.13
62 0.15
63 0.16
64 0.17
65 0.22
66 0.3
67 0.39
68 0.46
69 0.57
70 0.65
71 0.71
72 0.78
73 0.83
74 0.84
75 0.83
76 0.79
77 0.75
78 0.73
79 0.76
80 0.73
81 0.65
82 0.58
83 0.56
84 0.52
85 0.49
86 0.44
87 0.39
88 0.38
89 0.37
90 0.38
91 0.31
92 0.29
93 0.27
94 0.23
95 0.2
96 0.19
97 0.19
98 0.16
99 0.18
100 0.25
101 0.31
102 0.37
103 0.46
104 0.51
105 0.59
106 0.64