Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A370TJB4

Protein Details
Accession A0A370TJB4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPPKPFKPPRPSGRPRKSTSTTPHydrophilic
NLS Segment(s)
PositionSequence
4-44KPFKPPRPSGRPRKSTSTTPASGTKRAASSVPKRKTKTGAG
Subcellular Location(s) nucl 13.5, cyto_nucl 11, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018552  CENP-X  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006281  P:DNA repair  
GO:0051382  P:kinetochore assembly  
Pfam View protein in Pfam  
PF09415  CENP-X  
Amino Acid Sequences MPPKPFKPPRPSGRPRKSTSTTPASGTKRAASSVPKRKTKTGAGIEKIQGRRVSAREMGLPSLSPDSQPASHPSSAPASNPEDRDEGEDDTFAERTELRHGDGEGEGDADDGRQETIRPELLAVIVQQFFQEKGTRLGTGAKKAIGKYMETFVREGITRCVWARSEEMCGVEGASGILEVEDLEKLAPQLLMDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.86
3 0.85
4 0.8
5 0.78
6 0.75
7 0.73
8 0.64
9 0.58
10 0.61
11 0.56
12 0.54
13 0.48
14 0.43
15 0.36
16 0.35
17 0.34
18 0.35
19 0.41
20 0.47
21 0.54
22 0.59
23 0.62
24 0.66
25 0.68
26 0.67
27 0.66
28 0.65
29 0.65
30 0.61
31 0.62
32 0.6
33 0.62
34 0.56
35 0.51
36 0.42
37 0.35
38 0.35
39 0.32
40 0.33
41 0.28
42 0.28
43 0.27
44 0.27
45 0.26
46 0.22
47 0.2
48 0.17
49 0.16
50 0.15
51 0.11
52 0.11
53 0.12
54 0.13
55 0.14
56 0.17
57 0.19
58 0.2
59 0.2
60 0.2
61 0.21
62 0.21
63 0.2
64 0.19
65 0.19
66 0.21
67 0.22
68 0.23
69 0.2
70 0.2
71 0.22
72 0.2
73 0.17
74 0.14
75 0.13
76 0.12
77 0.12
78 0.12
79 0.09
80 0.07
81 0.06
82 0.06
83 0.1
84 0.1
85 0.1
86 0.11
87 0.11
88 0.12
89 0.12
90 0.12
91 0.08
92 0.08
93 0.06
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.07
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.08
117 0.09
118 0.12
119 0.11
120 0.15
121 0.16
122 0.16
123 0.16
124 0.24
125 0.25
126 0.28
127 0.28
128 0.27
129 0.28
130 0.28
131 0.32
132 0.26
133 0.25
134 0.22
135 0.26
136 0.26
137 0.25
138 0.26
139 0.21
140 0.22
141 0.21
142 0.2
143 0.19
144 0.17
145 0.18
146 0.19
147 0.21
148 0.2
149 0.22
150 0.24
151 0.21
152 0.25
153 0.24
154 0.24
155 0.22
156 0.21
157 0.19
158 0.15
159 0.13
160 0.08
161 0.06
162 0.05
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.05
169 0.05
170 0.05
171 0.06
172 0.06
173 0.08
174 0.08