Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A370TS46

Protein Details
Accession A0A370TS46    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
84-105VEMNREYKKWIKHKPARSCVAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 13.333, cyto 12, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR006056  RidA  
IPR019897  RidA_CS  
IPR035959  RutC-like_sf  
IPR006175  YjgF/YER057c/UK114  
Pfam View protein in Pfam  
PF01042  Ribonuc_L-PSP  
PROSITE View protein in PROSITE  
PS01094  UPF0076  
CDD cd00448  YjgF_YER057c_UK114_family  
Amino Acid Sequences MTPVLSKNAMPPVGPYSQAMKTPHAIYCSGQLPADAQGNLVEGSMAEKTKACLQALSVILDEAGSSVDKLVKVNIFLTDMDDFVEMNREYKKWIKHKPARSCVAVKQLPKGVNIEIEGIALP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.22
4 0.24
5 0.29
6 0.29
7 0.27
8 0.29
9 0.31
10 0.31
11 0.29
12 0.28
13 0.23
14 0.25
15 0.24
16 0.21
17 0.18
18 0.16
19 0.15
20 0.16
21 0.17
22 0.13
23 0.11
24 0.1
25 0.11
26 0.11
27 0.1
28 0.07
29 0.04
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.07
36 0.12
37 0.14
38 0.13
39 0.13
40 0.13
41 0.18
42 0.18
43 0.18
44 0.14
45 0.11
46 0.11
47 0.1
48 0.1
49 0.04
50 0.04
51 0.03
52 0.03
53 0.03
54 0.05
55 0.05
56 0.06
57 0.07
58 0.07
59 0.08
60 0.09
61 0.09
62 0.09
63 0.09
64 0.11
65 0.1
66 0.1
67 0.1
68 0.09
69 0.08
70 0.07
71 0.12
72 0.09
73 0.11
74 0.13
75 0.12
76 0.16
77 0.22
78 0.31
79 0.36
80 0.46
81 0.56
82 0.64
83 0.74
84 0.81
85 0.84
86 0.82
87 0.79
88 0.74
89 0.68
90 0.69
91 0.64
92 0.56
93 0.53
94 0.53
95 0.48
96 0.45
97 0.42
98 0.34
99 0.31
100 0.3
101 0.26
102 0.19