Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A370TG80

Protein Details
Accession A0A370TG80    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
197-223YFKLRELTKKERNREIRSRKWKYTWFGHydrophilic
NLS Segment(s)
PositionSequence
206-213KERNREIR
Subcellular Location(s) plas 16, E.R. 5, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07264  EI24  
Amino Acid Sequences MPPRTINREALLRPVKSIVSASFLYPCKGIWYFLTHREYYPLFGRRLIPLTITSIVVLTLLFIFTYLPQAAFLLIFHGPTAWVNAVFLVLGEGHVVTALLFEALLVDETLVDVFDATLIREGLISLVAPSRILDHDAPTAVKMLGKPITTAVYSPFSFRQIAEFILFLPLNLIPWVGVPAFLVLTGARGGPLHHWRYFKLRELTKKERNREIRSRKWKYTWFGTVALLLQLIPVLSMFFLLTSACGSALWAAKLEEQKTLVEEAEAAVVNEGAPPVYTDDPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.31
4 0.32
5 0.23
6 0.2
7 0.2
8 0.19
9 0.23
10 0.24
11 0.24
12 0.22
13 0.21
14 0.21
15 0.21
16 0.22
17 0.18
18 0.24
19 0.27
20 0.35
21 0.41
22 0.37
23 0.37
24 0.4
25 0.39
26 0.35
27 0.38
28 0.36
29 0.31
30 0.33
31 0.35
32 0.34
33 0.36
34 0.33
35 0.27
36 0.22
37 0.25
38 0.23
39 0.21
40 0.17
41 0.14
42 0.13
43 0.11
44 0.1
45 0.06
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.09
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.02
87 0.02
88 0.02
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.02
100 0.02
101 0.03
102 0.03
103 0.03
104 0.04
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.06
118 0.06
119 0.08
120 0.08
121 0.09
122 0.1
123 0.11
124 0.11
125 0.1
126 0.1
127 0.08
128 0.09
129 0.07
130 0.09
131 0.11
132 0.11
133 0.11
134 0.11
135 0.12
136 0.11
137 0.12
138 0.11
139 0.12
140 0.12
141 0.14
142 0.14
143 0.15
144 0.15
145 0.15
146 0.15
147 0.12
148 0.13
149 0.12
150 0.11
151 0.09
152 0.11
153 0.11
154 0.09
155 0.09
156 0.07
157 0.07
158 0.07
159 0.07
160 0.04
161 0.05
162 0.06
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.04
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.06
177 0.1
178 0.18
179 0.22
180 0.26
181 0.28
182 0.3
183 0.37
184 0.41
185 0.44
186 0.45
187 0.47
188 0.53
189 0.61
190 0.69
191 0.71
192 0.76
193 0.75
194 0.77
195 0.8
196 0.79
197 0.81
198 0.81
199 0.82
200 0.84
201 0.86
202 0.83
203 0.81
204 0.8
205 0.76
206 0.73
207 0.69
208 0.61
209 0.55
210 0.48
211 0.41
212 0.34
213 0.28
214 0.2
215 0.12
216 0.09
217 0.07
218 0.06
219 0.04
220 0.04
221 0.04
222 0.03
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.05
229 0.05
230 0.06
231 0.05
232 0.05
233 0.06
234 0.09
235 0.11
236 0.11
237 0.12
238 0.12
239 0.17
240 0.22
241 0.23
242 0.23
243 0.22
244 0.23
245 0.23
246 0.24
247 0.2
248 0.15
249 0.14
250 0.11
251 0.12
252 0.12
253 0.1
254 0.09
255 0.08
256 0.08
257 0.08
258 0.08
259 0.06
260 0.06
261 0.06
262 0.1