Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A370U088

Protein Details
Accession A0A370U088    Localization Confidence High Confidence Score 19
NoLS Segment(s)
PositionSequenceProtein Nature
4-25EISDIKNKGKRRVPREQRLIDGHydrophilic
NLS Segment(s)
PositionSequence
10-21NKGKRRVPREQR
28-36AARIKRNKK
83-84KG
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREISDIKNKGKRRVPREQRLIDGETAARIKRNKKTAIVKFKVRCQRHLYTLVLKDSEKVEKLKQSLPPNLTIADTPKKNAKGKRVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.78
4 0.8
5 0.85
6 0.8
7 0.77
8 0.73
9 0.67
10 0.56
11 0.46
12 0.36
13 0.27
14 0.24
15 0.19
16 0.18
17 0.2
18 0.26
19 0.31
20 0.39
21 0.4
22 0.46
23 0.56
24 0.61
25 0.68
26 0.67
27 0.68
28 0.64
29 0.68
30 0.7
31 0.62
32 0.58
33 0.54
34 0.53
35 0.49
36 0.5
37 0.45
38 0.42
39 0.44
40 0.4
41 0.34
42 0.3
43 0.26
44 0.24
45 0.24
46 0.2
47 0.19
48 0.21
49 0.25
50 0.28
51 0.32
52 0.37
53 0.41
54 0.47
55 0.47
56 0.46
57 0.43
58 0.4
59 0.37
60 0.31
61 0.29
62 0.3
63 0.29
64 0.29
65 0.36
66 0.42
67 0.49
68 0.55