Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1D569

Protein Details
Accession A1D569   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-37ASLSSSEKKRLRDRRAQENLRKKRENHIKYHydrophilic
NLS Segment(s)
PositionSequence
15-31KKRLRDRRAQENLRKKR
Subcellular Location(s) nucl 18, mito 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
KEGG nfi:NFIA_022730  -  
Pfam View protein in Pfam  
PF11905  DUF3425  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MVSNRHNASLSSSEKKRLRDRRAQENLRKKRENHIKYLEERVEFCERHHGASLMQQLLTAVDSLRRENELLRARQDRLRNMIVSWDADENGVVSSATSQQPRRLENAELDINPRTTCQCDRAKKGLAATPNLVANLEIPDLGAQNEIFTRTTGLTLEYAGTDPGLGHLNSVQDVAAAGPNILPSIQLPELPHSSAIQALPSTVPAWCLVPMNEYGHDPSLVPATSPWLIRRDLVIACPPVPAPLDLLHGTRRNYLANEIHRAIRRRAIRDAECVALGWLTYVYSKWRVSPNPATFARLAPFQQPLMTQIQQGHPTALDLIIWQQLRVNILRNWTKYDFTELTGYLGCCTKVRWPWGKDMLERDADDNLQIRQEFFEVFTRESGWGLTSEFIDKYPELMEGLDVEALRFRMILPSEVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.65
4 0.68
5 0.72
6 0.74
7 0.78
8 0.8
9 0.86
10 0.89
11 0.89
12 0.9
13 0.9
14 0.9
15 0.9
16 0.82
17 0.81
18 0.82
19 0.79
20 0.78
21 0.76
22 0.74
23 0.71
24 0.77
25 0.72
26 0.63
27 0.57
28 0.53
29 0.51
30 0.43
31 0.4
32 0.41
33 0.36
34 0.36
35 0.37
36 0.32
37 0.25
38 0.31
39 0.37
40 0.28
41 0.27
42 0.24
43 0.21
44 0.21
45 0.2
46 0.14
47 0.08
48 0.1
49 0.11
50 0.13
51 0.15
52 0.16
53 0.17
54 0.18
55 0.26
56 0.31
57 0.33
58 0.39
59 0.42
60 0.44
61 0.49
62 0.54
63 0.51
64 0.5
65 0.5
66 0.44
67 0.4
68 0.41
69 0.37
70 0.32
71 0.27
72 0.22
73 0.17
74 0.16
75 0.15
76 0.11
77 0.09
78 0.08
79 0.06
80 0.05
81 0.06
82 0.09
83 0.13
84 0.17
85 0.19
86 0.25
87 0.3
88 0.32
89 0.35
90 0.35
91 0.34
92 0.32
93 0.36
94 0.34
95 0.3
96 0.31
97 0.28
98 0.26
99 0.24
100 0.22
101 0.18
102 0.18
103 0.19
104 0.24
105 0.31
106 0.38
107 0.45
108 0.51
109 0.55
110 0.53
111 0.54
112 0.51
113 0.46
114 0.41
115 0.36
116 0.3
117 0.26
118 0.24
119 0.2
120 0.16
121 0.12
122 0.1
123 0.09
124 0.07
125 0.06
126 0.06
127 0.06
128 0.07
129 0.07
130 0.05
131 0.05
132 0.06
133 0.07
134 0.07
135 0.07
136 0.09
137 0.08
138 0.09
139 0.09
140 0.09
141 0.08
142 0.08
143 0.08
144 0.07
145 0.07
146 0.07
147 0.06
148 0.05
149 0.05
150 0.05
151 0.07
152 0.06
153 0.06
154 0.08
155 0.08
156 0.08
157 0.09
158 0.07
159 0.05
160 0.05
161 0.06
162 0.05
163 0.05
164 0.04
165 0.04
166 0.04
167 0.05
168 0.04
169 0.04
170 0.03
171 0.07
172 0.07
173 0.09
174 0.09
175 0.12
176 0.14
177 0.14
178 0.14
179 0.11
180 0.11
181 0.11
182 0.1
183 0.08
184 0.07
185 0.07
186 0.06
187 0.06
188 0.07
189 0.05
190 0.06
191 0.06
192 0.06
193 0.06
194 0.07
195 0.07
196 0.08
197 0.09
198 0.1
199 0.1
200 0.1
201 0.11
202 0.1
203 0.11
204 0.09
205 0.08
206 0.09
207 0.08
208 0.07
209 0.06
210 0.09
211 0.1
212 0.11
213 0.12
214 0.13
215 0.14
216 0.14
217 0.15
218 0.15
219 0.14
220 0.15
221 0.17
222 0.15
223 0.15
224 0.15
225 0.14
226 0.12
227 0.12
228 0.11
229 0.09
230 0.09
231 0.11
232 0.12
233 0.13
234 0.16
235 0.19
236 0.2
237 0.21
238 0.21
239 0.2
240 0.2
241 0.23
242 0.25
243 0.25
244 0.29
245 0.29
246 0.32
247 0.35
248 0.38
249 0.35
250 0.36
251 0.38
252 0.37
253 0.41
254 0.45
255 0.43
256 0.44
257 0.45
258 0.39
259 0.33
260 0.29
261 0.23
262 0.15
263 0.12
264 0.08
265 0.05
266 0.04
267 0.05
268 0.05
269 0.08
270 0.12
271 0.13
272 0.16
273 0.23
274 0.25
275 0.33
276 0.43
277 0.44
278 0.47
279 0.47
280 0.47
281 0.42
282 0.41
283 0.35
284 0.27
285 0.24
286 0.2
287 0.21
288 0.18
289 0.18
290 0.16
291 0.18
292 0.21
293 0.21
294 0.2
295 0.21
296 0.25
297 0.27
298 0.27
299 0.25
300 0.19
301 0.19
302 0.17
303 0.14
304 0.1
305 0.07
306 0.08
307 0.12
308 0.12
309 0.11
310 0.12
311 0.14
312 0.16
313 0.18
314 0.21
315 0.18
316 0.26
317 0.33
318 0.33
319 0.39
320 0.39
321 0.4
322 0.36
323 0.42
324 0.35
325 0.31
326 0.32
327 0.26
328 0.25
329 0.25
330 0.24
331 0.18
332 0.18
333 0.16
334 0.13
335 0.14
336 0.19
337 0.23
338 0.32
339 0.41
340 0.43
341 0.51
342 0.6
343 0.64
344 0.62
345 0.62
346 0.58
347 0.53
348 0.51
349 0.43
350 0.36
351 0.31
352 0.28
353 0.24
354 0.19
355 0.19
356 0.18
357 0.17
358 0.16
359 0.17
360 0.16
361 0.16
362 0.22
363 0.21
364 0.22
365 0.23
366 0.23
367 0.23
368 0.22
369 0.2
370 0.15
371 0.13
372 0.12
373 0.13
374 0.12
375 0.14
376 0.14
377 0.14
378 0.17
379 0.16
380 0.16
381 0.16
382 0.15
383 0.13
384 0.13
385 0.13
386 0.1
387 0.11
388 0.12
389 0.11
390 0.1
391 0.12
392 0.12
393 0.12
394 0.11
395 0.1
396 0.14
397 0.16