Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A370U098

Protein Details
Accession A0A370U098    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
171-214TQSTKTPKDKEARKREKAARNDKLKKEKEQKRKEAANKSKKAAEBasic
NLS Segment(s)
PositionSequence
175-214KTPKDKEARKREKAARNDKLKKEKEQKRKEAANKSKKAAE
Subcellular Location(s) mito 13, mito_nucl 11.333, cyto_mito 8.833, nucl 8.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSAFPPHRSIASIPVSPEIALKFLSTYLEKTNTLPYLLPNAKLEPSGPTAGSSASSVTIHNLQRIEAGLKGEWLAPTLELEAEDADAIAVETPKNPEGEGEAEGWQDLDEYQREQSVEEGGIGPRQTGVAQEGVPNSVPDEEQGEEQDEEELDAPKAKKLKTEHKPDGELTQSTKTPKDKEARKREKAARNDKLKKEKEQKRKEAANKSKKAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.27
4 0.27
5 0.2
6 0.15
7 0.14
8 0.12
9 0.11
10 0.11
11 0.13
12 0.13
13 0.15
14 0.18
15 0.21
16 0.22
17 0.23
18 0.28
19 0.26
20 0.26
21 0.24
22 0.21
23 0.27
24 0.28
25 0.29
26 0.25
27 0.26
28 0.25
29 0.25
30 0.24
31 0.18
32 0.2
33 0.19
34 0.17
35 0.16
36 0.16
37 0.16
38 0.16
39 0.13
40 0.09
41 0.09
42 0.09
43 0.08
44 0.1
45 0.16
46 0.16
47 0.18
48 0.18
49 0.17
50 0.17
51 0.18
52 0.17
53 0.13
54 0.14
55 0.11
56 0.11
57 0.11
58 0.11
59 0.1
60 0.1
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.06
67 0.06
68 0.05
69 0.05
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07
84 0.09
85 0.1
86 0.11
87 0.11
88 0.1
89 0.1
90 0.1
91 0.1
92 0.08
93 0.06
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.07
100 0.08
101 0.08
102 0.08
103 0.08
104 0.07
105 0.07
106 0.08
107 0.07
108 0.08
109 0.08
110 0.07
111 0.06
112 0.06
113 0.06
114 0.06
115 0.07
116 0.07
117 0.07
118 0.09
119 0.09
120 0.1
121 0.1
122 0.1
123 0.09
124 0.08
125 0.08
126 0.06
127 0.08
128 0.08
129 0.09
130 0.1
131 0.11
132 0.11
133 0.11
134 0.11
135 0.09
136 0.09
137 0.09
138 0.09
139 0.07
140 0.12
141 0.12
142 0.14
143 0.19
144 0.19
145 0.24
146 0.3
147 0.41
148 0.46
149 0.57
150 0.63
151 0.65
152 0.68
153 0.64
154 0.61
155 0.54
156 0.47
157 0.4
158 0.34
159 0.31
160 0.3
161 0.34
162 0.34
163 0.34
164 0.4
165 0.47
166 0.52
167 0.6
168 0.69
169 0.75
170 0.78
171 0.84
172 0.86
173 0.86
174 0.87
175 0.88
176 0.86
177 0.87
178 0.88
179 0.88
180 0.89
181 0.86
182 0.86
183 0.86
184 0.86
185 0.86
186 0.87
187 0.87
188 0.87
189 0.91
190 0.9
191 0.9
192 0.91
193 0.91
194 0.88