Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A370TBK7

Protein Details
Accession A0A370TBK7    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-41MSRRPEKTLRDRIEQRRWTRVWVKRELERMKRQREKEREEKBasic
NLS Segment(s)
PositionSequence
16-48RRWTRVWVKRELERMKRQREKEREEKAMKKKKG
78-94EKEEKEEKKKIGGRKRS
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSRRPEKTLRDRIEQRRWTRVWVKRELERMKRQREKEREEKAMKKKKGAEEAEEAEEAEEAEEAEEAEEAEEKEEKEEKEEKEEKKKIGGRKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.77
4 0.72
5 0.7
6 0.7
7 0.68
8 0.65
9 0.65
10 0.64
11 0.61
12 0.7
13 0.7
14 0.7
15 0.73
16 0.74
17 0.75
18 0.79
19 0.8
20 0.81
21 0.81
22 0.8
23 0.8
24 0.78
25 0.77
26 0.75
27 0.77
28 0.77
29 0.77
30 0.71
31 0.66
32 0.65
33 0.6
34 0.62
35 0.55
36 0.49
37 0.43
38 0.44
39 0.4
40 0.34
41 0.29
42 0.19
43 0.17
44 0.13
45 0.08
46 0.05
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.05
56 0.05
57 0.06
58 0.08
59 0.08
60 0.11
61 0.15
62 0.15
63 0.2
64 0.26
65 0.27
66 0.35
67 0.42
68 0.47
69 0.54
70 0.6
71 0.57
72 0.61
73 0.65
74 0.66