Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A370U0D4

Protein Details
Accession A0A370U0D4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-43KLKGAAAGVTKKKKKKKSKSSSSESKALEHydrophilic
NLS Segment(s)
PositionSequence
15-34KLKGAAAGVTKKKKKKKSKS
Subcellular Location(s) nucl 24, cyto_nucl 13.333, mito_nucl 13.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSDDYAPIVRGGLKLKGAAAGVTKKKKKKKSKSSSSESKALETALKDRDDERRVEEQDGAVRKKEKDTREGGEDDGEEVDGQDMRELEHRDPNDGKTASERAYEETRRKRLQERLLREGPPKTHKQRVEELNKYLSNLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.19
5 0.17
6 0.16
7 0.18
8 0.23
9 0.3
10 0.39
11 0.47
12 0.54
13 0.64
14 0.73
15 0.8
16 0.83
17 0.86
18 0.88
19 0.91
20 0.92
21 0.92
22 0.92
23 0.87
24 0.83
25 0.73
26 0.63
27 0.52
28 0.43
29 0.36
30 0.26
31 0.24
32 0.2
33 0.2
34 0.19
35 0.2
36 0.27
37 0.27
38 0.27
39 0.29
40 0.31
41 0.33
42 0.33
43 0.32
44 0.26
45 0.28
46 0.32
47 0.28
48 0.24
49 0.25
50 0.24
51 0.3
52 0.35
53 0.33
54 0.34
55 0.37
56 0.38
57 0.39
58 0.39
59 0.33
60 0.28
61 0.25
62 0.19
63 0.14
64 0.11
65 0.06
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.09
74 0.12
75 0.13
76 0.17
77 0.18
78 0.21
79 0.23
80 0.24
81 0.27
82 0.25
83 0.24
84 0.22
85 0.25
86 0.22
87 0.22
88 0.22
89 0.19
90 0.25
91 0.3
92 0.36
93 0.42
94 0.49
95 0.51
96 0.55
97 0.58
98 0.61
99 0.66
100 0.67
101 0.66
102 0.67
103 0.69
104 0.69
105 0.66
106 0.62
107 0.58
108 0.56
109 0.57
110 0.56
111 0.6
112 0.61
113 0.62
114 0.66
115 0.7
116 0.72
117 0.7
118 0.67
119 0.65
120 0.6
121 0.56
122 0.48
123 0.39
124 0.32
125 0.26
126 0.26
127 0.24
128 0.24
129 0.26
130 0.3
131 0.29