Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LSZ9

Protein Details
Accession E2LSZ9   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
228-252GRITPQKAYKSHRRVSRRRLEAKTEHydrophilic
NLS Segment(s)
PositionSequence
242-242R
244-246SRR
Subcellular Location(s) mito 5cyto 5extr 5cyto_mito 5, plas 4, cyto_nucl 4, E.R. 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001441  UPP_synth-like  
IPR036424  UPP_synth-like_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0016765  F:transferase activity, transferring alkyl or aryl (other than methyl) groups  
GO:0019408  P:dolichol biosynthetic process  
KEGG mpr:MPER_10182  -  
Pfam View protein in Pfam  
PF01255  Prenyltransf  
CDD cd00475  Cis_IPPS  
Amino Acid Sequences MLREVLLTLYSVLIFILTPFLVLLSLLHLNSVKDYPKRLLFKVLAAGPVPQHVAFVMDGNRRYARMLGKEVKHGHGEGYESLRRAIYAFAIENFKRSKQEVDTLMALAVDKLDELCRHGDLLNQYNVRLNVIGRTDLFPSHVKTVVKKPEDLTRMNDGFILNICMPYESTDEIRTAVDSAPITITPEKXTSRLMTTERGSPPRVDILIRTSGVTRLSDIMLWQRAVWSGRITPQKAYKSHRRVSRRRLEAKTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.07
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.07
12 0.09
13 0.09
14 0.11
15 0.12
16 0.12
17 0.14
18 0.17
19 0.19
20 0.21
21 0.25
22 0.3
23 0.37
24 0.42
25 0.41
26 0.46
27 0.42
28 0.42
29 0.44
30 0.4
31 0.34
32 0.29
33 0.29
34 0.21
35 0.21
36 0.2
37 0.14
38 0.12
39 0.1
40 0.11
41 0.1
42 0.12
43 0.15
44 0.18
45 0.19
46 0.22
47 0.23
48 0.22
49 0.23
50 0.24
51 0.24
52 0.25
53 0.32
54 0.36
55 0.37
56 0.45
57 0.47
58 0.46
59 0.42
60 0.38
61 0.31
62 0.24
63 0.24
64 0.18
65 0.2
66 0.19
67 0.18
68 0.18
69 0.17
70 0.16
71 0.15
72 0.13
73 0.09
74 0.09
75 0.09
76 0.1
77 0.15
78 0.15
79 0.18
80 0.19
81 0.2
82 0.2
83 0.21
84 0.23
85 0.2
86 0.26
87 0.25
88 0.27
89 0.26
90 0.24
91 0.22
92 0.19
93 0.16
94 0.1
95 0.07
96 0.04
97 0.03
98 0.03
99 0.04
100 0.04
101 0.06
102 0.07
103 0.07
104 0.08
105 0.08
106 0.11
107 0.13
108 0.16
109 0.19
110 0.19
111 0.19
112 0.2
113 0.2
114 0.18
115 0.15
116 0.12
117 0.1
118 0.1
119 0.11
120 0.09
121 0.1
122 0.11
123 0.1
124 0.13
125 0.12
126 0.14
127 0.15
128 0.18
129 0.17
130 0.19
131 0.27
132 0.33
133 0.33
134 0.33
135 0.33
136 0.36
137 0.4
138 0.39
139 0.36
140 0.35
141 0.33
142 0.32
143 0.31
144 0.24
145 0.2
146 0.18
147 0.17
148 0.09
149 0.09
150 0.09
151 0.08
152 0.08
153 0.1
154 0.11
155 0.1
156 0.11
157 0.12
158 0.12
159 0.13
160 0.13
161 0.11
162 0.11
163 0.09
164 0.1
165 0.09
166 0.1
167 0.1
168 0.1
169 0.12
170 0.13
171 0.14
172 0.14
173 0.16
174 0.18
175 0.18
176 0.21
177 0.19
178 0.21
179 0.23
180 0.24
181 0.25
182 0.31
183 0.35
184 0.37
185 0.38
186 0.35
187 0.35
188 0.35
189 0.33
190 0.26
191 0.22
192 0.23
193 0.25
194 0.25
195 0.23
196 0.2
197 0.21
198 0.22
199 0.21
200 0.17
201 0.14
202 0.14
203 0.14
204 0.14
205 0.19
206 0.2
207 0.2
208 0.19
209 0.18
210 0.2
211 0.22
212 0.22
213 0.19
214 0.19
215 0.26
216 0.35
217 0.36
218 0.39
219 0.46
220 0.52
221 0.55
222 0.61
223 0.65
224 0.66
225 0.72
226 0.76
227 0.78
228 0.81
229 0.85
230 0.87
231 0.87
232 0.87