Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A370TJ86

Protein Details
Accession A0A370TJ86    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-38NVPSKQRRTASRAKVQRRKSVNKVTKNPRGTHydrophilic
NLS Segment(s)
PositionSequence
13-34QRRTASRAKVQRRKSVNKVTKN
56-71GKKAKKLERAQNHARR
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
Amino Acid Sequences MASRSNPNVPSKQRRTASRAKVQRRKSVNKVTKNPRGTAKSNVLCPTSGPAAPLSGKKAKKLERAQNHARRRAIELAMENEGEVEMIDPPTTKAKTENAANEKMELDDIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.74
3 0.75
4 0.76
5 0.75
6 0.78
7 0.79
8 0.82
9 0.82
10 0.84
11 0.83
12 0.82
13 0.81
14 0.82
15 0.81
16 0.82
17 0.84
18 0.84
19 0.84
20 0.79
21 0.73
22 0.7
23 0.66
24 0.6
25 0.56
26 0.56
27 0.49
28 0.49
29 0.48
30 0.41
31 0.35
32 0.31
33 0.27
34 0.2
35 0.17
36 0.13
37 0.11
38 0.11
39 0.12
40 0.13
41 0.14
42 0.19
43 0.2
44 0.23
45 0.3
46 0.34
47 0.42
48 0.5
49 0.56
50 0.58
51 0.65
52 0.72
53 0.76
54 0.78
55 0.76
56 0.7
57 0.62
58 0.57
59 0.53
60 0.44
61 0.37
62 0.32
63 0.28
64 0.27
65 0.25
66 0.2
67 0.15
68 0.14
69 0.1
70 0.07
71 0.05
72 0.04
73 0.05
74 0.05
75 0.06
76 0.08
77 0.14
78 0.14
79 0.15
80 0.17
81 0.21
82 0.27
83 0.33
84 0.42
85 0.42
86 0.47
87 0.47
88 0.45
89 0.42
90 0.37