Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A370TXI2

Protein Details
Accession A0A370TXI2    Localization Confidence High Confidence Score 20.3
NoLS Segment(s)
PositionSequenceProtein Nature
511-532SPEMNKKKAKTLKSPPQPPPEIHydrophilic
658-678NTSPNASNKRRRPSAVKEDADHydrophilic
685-705QAKPGVKPSPRIGKRQKPNATHydrophilic
NLS Segment(s)
PositionSequence
516-520KKKAK
691-701KPSPRIGKRQK
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029005  LIM-bd/SEUSS  
Pfam View protein in Pfam  
PF01803  LIM_bind  
Amino Acid Sequences MMTSLAQAYSPHPGGIQQHPGVSQGHPMAVPHNPGQQGQPGMPQQMHMGVSGPGGPQVTQAGALMGGIPQGAGGPSAHALQHLNPNHAQQAQMLQQQQAMAFAPQFQMQQQHIIQQQQRAQAARQAMMAQHYSGMPVNMPNGMGQMTNAQYQAMRGAGPMARPVNVNLPQHLQQQQQQAQHSLEQQQQAQAQAQHQQQQQQLLAQQMAMQQQANIQAQGGANQGQHNQPNPQLLQNMQQGQITQAQQAHQQAASQQNQPPQSQPQPQPQQPQPNPQAAQPQQPQQPAQPPQPGIQQQAAAAAMMQQRQQVEKLRGQCLMKLMQFADHLSNFGVSSKPLQSYMASGAQRLAAQGSKQRDDLNYWLHFVDRFFSPKGVLRHSVWIVDETSNKQYEITFPALARYFHTHFESGIKTMQLIMEKGSERDLPNNGHYIESPKSSFVYWFDNGSQLIANGTLRAHFDADQKIELLEFVTSNHEEYLPRTRIIEAARPLHDWGKEWQKVNAPPEGKQSPEMNKKKAKTLKSPPQPPPEIEIPPSKVKPSMGITPSVFRFLELAEVMGQMNPLFGYSHQHLALAPYAALDQYVATVAATSGMNPGGQQNPSGPRTPGLGNFAMGASPAAAHLALPDGSPHMSGSPAQAPGMQLQQSQQGSSGPSANTSPNASNKRRRPSAVKEDADNQPNGTQAKPGVKPSPRIGKRQKPNAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.37
4 0.31
5 0.33
6 0.33
7 0.35
8 0.34
9 0.29
10 0.28
11 0.22
12 0.21
13 0.2
14 0.2
15 0.21
16 0.23
17 0.27
18 0.24
19 0.29
20 0.29
21 0.3
22 0.32
23 0.34
24 0.34
25 0.3
26 0.34
27 0.31
28 0.33
29 0.32
30 0.3
31 0.26
32 0.27
33 0.26
34 0.2
35 0.18
36 0.14
37 0.15
38 0.15
39 0.14
40 0.11
41 0.12
42 0.11
43 0.11
44 0.12
45 0.12
46 0.1
47 0.1
48 0.09
49 0.08
50 0.08
51 0.07
52 0.06
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.07
63 0.09
64 0.09
65 0.1
66 0.11
67 0.14
68 0.23
69 0.24
70 0.28
71 0.29
72 0.31
73 0.34
74 0.33
75 0.31
76 0.23
77 0.26
78 0.27
79 0.31
80 0.3
81 0.27
82 0.28
83 0.28
84 0.27
85 0.22
86 0.18
87 0.13
88 0.11
89 0.12
90 0.12
91 0.13
92 0.14
93 0.14
94 0.18
95 0.18
96 0.24
97 0.24
98 0.28
99 0.31
100 0.37
101 0.4
102 0.41
103 0.44
104 0.44
105 0.47
106 0.43
107 0.41
108 0.38
109 0.37
110 0.32
111 0.28
112 0.24
113 0.21
114 0.22
115 0.22
116 0.17
117 0.15
118 0.14
119 0.14
120 0.14
121 0.13
122 0.1
123 0.1
124 0.11
125 0.11
126 0.11
127 0.09
128 0.09
129 0.1
130 0.09
131 0.08
132 0.11
133 0.12
134 0.13
135 0.13
136 0.13
137 0.12
138 0.13
139 0.14
140 0.1
141 0.09
142 0.07
143 0.1
144 0.11
145 0.12
146 0.16
147 0.16
148 0.16
149 0.17
150 0.18
151 0.23
152 0.28
153 0.29
154 0.26
155 0.29
156 0.31
157 0.36
158 0.4
159 0.35
160 0.34
161 0.42
162 0.46
163 0.46
164 0.46
165 0.44
166 0.41
167 0.4
168 0.38
169 0.34
170 0.32
171 0.3
172 0.29
173 0.29
174 0.29
175 0.27
176 0.27
177 0.24
178 0.22
179 0.26
180 0.28
181 0.32
182 0.33
183 0.37
184 0.36
185 0.37
186 0.36
187 0.31
188 0.3
189 0.25
190 0.23
191 0.18
192 0.17
193 0.16
194 0.17
195 0.15
196 0.13
197 0.11
198 0.13
199 0.18
200 0.17
201 0.15
202 0.13
203 0.14
204 0.14
205 0.15
206 0.15
207 0.11
208 0.12
209 0.13
210 0.15
211 0.16
212 0.19
213 0.2
214 0.21
215 0.22
216 0.25
217 0.25
218 0.25
219 0.24
220 0.22
221 0.26
222 0.29
223 0.29
224 0.25
225 0.25
226 0.22
227 0.22
228 0.26
229 0.21
230 0.18
231 0.17
232 0.17
233 0.2
234 0.21
235 0.21
236 0.16
237 0.16
238 0.17
239 0.23
240 0.25
241 0.26
242 0.27
243 0.3
244 0.33
245 0.34
246 0.33
247 0.32
248 0.36
249 0.4
250 0.42
251 0.47
252 0.53
253 0.56
254 0.61
255 0.61
256 0.66
257 0.61
258 0.65
259 0.59
260 0.58
261 0.54
262 0.48
263 0.51
264 0.42
265 0.47
266 0.41
267 0.43
268 0.41
269 0.43
270 0.42
271 0.36
272 0.42
273 0.38
274 0.4
275 0.39
276 0.35
277 0.34
278 0.39
279 0.39
280 0.33
281 0.3
282 0.25
283 0.2
284 0.2
285 0.18
286 0.12
287 0.09
288 0.09
289 0.1
290 0.1
291 0.11
292 0.11
293 0.12
294 0.13
295 0.16
296 0.19
297 0.21
298 0.25
299 0.29
300 0.29
301 0.33
302 0.32
303 0.31
304 0.28
305 0.28
306 0.24
307 0.2
308 0.18
309 0.16
310 0.16
311 0.16
312 0.15
313 0.11
314 0.11
315 0.1
316 0.1
317 0.08
318 0.08
319 0.08
320 0.06
321 0.08
322 0.09
323 0.1
324 0.1
325 0.11
326 0.1
327 0.11
328 0.14
329 0.17
330 0.15
331 0.15
332 0.15
333 0.15
334 0.14
335 0.13
336 0.11
337 0.06
338 0.07
339 0.12
340 0.14
341 0.15
342 0.16
343 0.17
344 0.17
345 0.19
346 0.22
347 0.23
348 0.2
349 0.2
350 0.19
351 0.18
352 0.18
353 0.15
354 0.14
355 0.1
356 0.12
357 0.11
358 0.12
359 0.13
360 0.17
361 0.2
362 0.21
363 0.23
364 0.21
365 0.25
366 0.25
367 0.25
368 0.2
369 0.19
370 0.17
371 0.15
372 0.16
373 0.14
374 0.16
375 0.16
376 0.16
377 0.15
378 0.13
379 0.14
380 0.16
381 0.16
382 0.15
383 0.14
384 0.16
385 0.18
386 0.18
387 0.18
388 0.19
389 0.18
390 0.19
391 0.21
392 0.19
393 0.18
394 0.21
395 0.2
396 0.16
397 0.16
398 0.14
399 0.12
400 0.12
401 0.12
402 0.11
403 0.1
404 0.09
405 0.11
406 0.12
407 0.12
408 0.13
409 0.15
410 0.14
411 0.17
412 0.2
413 0.19
414 0.2
415 0.23
416 0.21
417 0.19
418 0.19
419 0.2
420 0.18
421 0.18
422 0.17
423 0.15
424 0.15
425 0.15
426 0.16
427 0.14
428 0.18
429 0.16
430 0.18
431 0.17
432 0.18
433 0.18
434 0.17
435 0.15
436 0.1
437 0.09
438 0.08
439 0.07
440 0.06
441 0.06
442 0.06
443 0.07
444 0.08
445 0.09
446 0.1
447 0.14
448 0.17
449 0.18
450 0.18
451 0.17
452 0.16
453 0.15
454 0.13
455 0.1
456 0.07
457 0.05
458 0.06
459 0.09
460 0.09
461 0.1
462 0.1
463 0.11
464 0.11
465 0.13
466 0.22
467 0.21
468 0.21
469 0.21
470 0.21
471 0.24
472 0.26
473 0.3
474 0.26
475 0.29
476 0.3
477 0.31
478 0.32
479 0.32
480 0.3
481 0.25
482 0.26
483 0.31
484 0.34
485 0.34
486 0.36
487 0.4
488 0.44
489 0.45
490 0.46
491 0.38
492 0.35
493 0.42
494 0.4
495 0.35
496 0.33
497 0.36
498 0.38
499 0.47
500 0.52
501 0.52
502 0.58
503 0.59
504 0.65
505 0.67
506 0.65
507 0.65
508 0.69
509 0.72
510 0.74
511 0.82
512 0.81
513 0.82
514 0.79
515 0.7
516 0.65
517 0.59
518 0.52
519 0.45
520 0.42
521 0.38
522 0.4
523 0.4
524 0.36
525 0.33
526 0.3
527 0.32
528 0.3
529 0.34
530 0.29
531 0.32
532 0.32
533 0.35
534 0.35
535 0.34
536 0.29
537 0.22
538 0.2
539 0.16
540 0.17
541 0.13
542 0.13
543 0.09
544 0.1
545 0.1
546 0.1
547 0.1
548 0.07
549 0.07
550 0.06
551 0.06
552 0.06
553 0.06
554 0.12
555 0.14
556 0.18
557 0.18
558 0.18
559 0.18
560 0.2
561 0.21
562 0.16
563 0.14
564 0.1
565 0.1
566 0.1
567 0.09
568 0.07
569 0.05
570 0.05
571 0.05
572 0.05
573 0.04
574 0.05
575 0.05
576 0.06
577 0.06
578 0.06
579 0.07
580 0.08
581 0.08
582 0.08
583 0.11
584 0.14
585 0.14
586 0.15
587 0.19
588 0.25
589 0.28
590 0.31
591 0.29
592 0.26
593 0.29
594 0.31
595 0.29
596 0.28
597 0.26
598 0.23
599 0.23
600 0.22
601 0.18
602 0.16
603 0.12
604 0.07
605 0.06
606 0.05
607 0.05
608 0.05
609 0.05
610 0.05
611 0.07
612 0.07
613 0.07
614 0.08
615 0.09
616 0.1
617 0.11
618 0.11
619 0.09
620 0.1
621 0.11
622 0.15
623 0.17
624 0.17
625 0.17
626 0.18
627 0.19
628 0.2
629 0.25
630 0.22
631 0.19
632 0.19
633 0.26
634 0.26
635 0.25
636 0.23
637 0.2
638 0.21
639 0.22
640 0.25
641 0.18
642 0.19
643 0.21
644 0.22
645 0.22
646 0.24
647 0.26
648 0.32
649 0.41
650 0.47
651 0.56
652 0.63
653 0.71
654 0.74
655 0.77
656 0.77
657 0.78
658 0.81
659 0.81
660 0.76
661 0.7
662 0.69
663 0.71
664 0.67
665 0.58
666 0.48
667 0.39
668 0.39
669 0.36
670 0.3
671 0.25
672 0.25
673 0.32
674 0.34
675 0.39
676 0.44
677 0.49
678 0.55
679 0.6
680 0.66
681 0.64
682 0.71
683 0.75
684 0.76
685 0.81