Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1D691

Protein Details
Accession A1D691    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGDRSRSRSPRRRYDEDRSRPRKTGBasic
52-71RDRGDRPRSPRRDRDSDRYRBasic
89-111DDNQKDERREKKKEKPEKKAVVABasic
NLS Segment(s)
PositionSequence
6-69RSRSPRRRYDEDRSRPRKTGGGFRWKDKRHDGDRPGAEDSRLSRGYRDRGDRPRSPRRDRDSDR
77-107GDRDRDRDRRRPDDNQKDERREKKKEKPEKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
KEGG nfi:NFIA_063990  -  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MGDRSRSRSPRRRYDEDRSRPRKTGGGFRWKDKRHDGDRPGAEDSRLSRGYRDRGDRPRSPRRDRDSDRYRDSYRDGDRDRDRDRRRPDDNQKDERREKKKEKPEKKAVVAPQSSEPMIVVHVNDRLGTKAAIPCLASDPIKLFKAQVAARIGREPHEILLKRQGERPFKDQLTLEDYGVSNGVQLDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.89
5 0.86
6 0.84
7 0.78
8 0.73
9 0.68
10 0.61
11 0.61
12 0.59
13 0.62
14 0.59
15 0.64
16 0.71
17 0.69
18 0.71
19 0.69
20 0.69
21 0.66
22 0.72
23 0.69
24 0.69
25 0.68
26 0.65
27 0.6
28 0.52
29 0.44
30 0.36
31 0.33
32 0.3
33 0.28
34 0.25
35 0.24
36 0.28
37 0.35
38 0.39
39 0.44
40 0.46
41 0.53
42 0.6
43 0.65
44 0.68
45 0.72
46 0.75
47 0.77
48 0.78
49 0.77
50 0.79
51 0.79
52 0.8
53 0.79
54 0.78
55 0.75
56 0.72
57 0.65
58 0.57
59 0.53
60 0.5
61 0.44
62 0.44
63 0.4
64 0.41
65 0.44
66 0.48
67 0.51
68 0.53
69 0.55
70 0.56
71 0.62
72 0.62
73 0.63
74 0.67
75 0.72
76 0.73
77 0.76
78 0.77
79 0.76
80 0.76
81 0.78
82 0.77
83 0.74
84 0.72
85 0.72
86 0.72
87 0.76
88 0.79
89 0.82
90 0.83
91 0.86
92 0.84
93 0.8
94 0.76
95 0.7
96 0.68
97 0.58
98 0.5
99 0.41
100 0.35
101 0.31
102 0.24
103 0.19
104 0.11
105 0.11
106 0.09
107 0.07
108 0.07
109 0.09
110 0.09
111 0.09
112 0.1
113 0.1
114 0.1
115 0.1
116 0.11
117 0.12
118 0.13
119 0.13
120 0.13
121 0.13
122 0.15
123 0.17
124 0.15
125 0.14
126 0.16
127 0.18
128 0.19
129 0.19
130 0.16
131 0.15
132 0.22
133 0.22
134 0.25
135 0.26
136 0.28
137 0.29
138 0.33
139 0.32
140 0.28
141 0.3
142 0.26
143 0.22
144 0.29
145 0.29
146 0.28
147 0.37
148 0.4
149 0.38
150 0.43
151 0.5
152 0.5
153 0.54
154 0.55
155 0.55
156 0.51
157 0.53
158 0.49
159 0.45
160 0.42
161 0.38
162 0.34
163 0.27
164 0.26
165 0.23
166 0.22
167 0.17
168 0.12