Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A370U069

Protein Details
Accession A0A370U069    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
331-353TMILARYESKKWKKRLETSGFIAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, cyto_mito 9.833, cyto_nucl 7.833, extr 7, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003495  CobW/HypB/UreG_dom  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF02492  cobW  
CDD cd03112  CobW-like  
Amino Acid Sequences MSPIPITIITGFLGSGKTTLLLNLLPQLRAQNPSYKLALVKNEFGDVAIDSQLASASSITGVRELLNGCICCNLVGQLDTALEELRNTINPDRIVIETSGSAFPATLAMEVNRLARDTNGAYLLDGVVTVIDVENWKGYEDTSYTAKIQARYTDLIVLNKWEIAGERRLDECLDRVGDLEVQVATVKSDKGRVPMDLVFGVDGALARSLGTEASDGETANGHAAGHDHAKSHQSEVEVLSITLRGDAGSTVDTSKLENLLKSAPKDEVYRIKAVLAASSPVPSPDGNVIEAELAESGRYILNWAFGRWTCTAMSSASDEHESSTGEVLRMTMILARYESKKWKKRLETSGFIALDNDADGTLDVEKIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.08
6 0.09
7 0.09
8 0.09
9 0.1
10 0.16
11 0.18
12 0.18
13 0.19
14 0.23
15 0.24
16 0.28
17 0.3
18 0.31
19 0.33
20 0.37
21 0.37
22 0.35
23 0.35
24 0.35
25 0.41
26 0.37
27 0.38
28 0.34
29 0.34
30 0.32
31 0.29
32 0.25
33 0.17
34 0.14
35 0.11
36 0.09
37 0.08
38 0.08
39 0.08
40 0.07
41 0.07
42 0.05
43 0.05
44 0.06
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.1
51 0.11
52 0.13
53 0.17
54 0.17
55 0.16
56 0.17
57 0.17
58 0.15
59 0.15
60 0.13
61 0.1
62 0.1
63 0.11
64 0.1
65 0.1
66 0.1
67 0.1
68 0.09
69 0.07
70 0.07
71 0.07
72 0.08
73 0.09
74 0.12
75 0.14
76 0.19
77 0.19
78 0.2
79 0.21
80 0.21
81 0.21
82 0.18
83 0.17
84 0.12
85 0.14
86 0.13
87 0.11
88 0.1
89 0.08
90 0.08
91 0.08
92 0.07
93 0.06
94 0.06
95 0.06
96 0.07
97 0.08
98 0.1
99 0.09
100 0.09
101 0.09
102 0.09
103 0.11
104 0.11
105 0.12
106 0.12
107 0.12
108 0.11
109 0.11
110 0.11
111 0.08
112 0.07
113 0.05
114 0.03
115 0.03
116 0.03
117 0.02
118 0.03
119 0.03
120 0.04
121 0.05
122 0.05
123 0.06
124 0.06
125 0.06
126 0.07
127 0.08
128 0.1
129 0.11
130 0.12
131 0.12
132 0.17
133 0.19
134 0.2
135 0.21
136 0.21
137 0.22
138 0.22
139 0.22
140 0.23
141 0.22
142 0.2
143 0.19
144 0.18
145 0.15
146 0.14
147 0.13
148 0.08
149 0.07
150 0.09
151 0.12
152 0.12
153 0.13
154 0.13
155 0.14
156 0.14
157 0.14
158 0.12
159 0.11
160 0.1
161 0.08
162 0.08
163 0.09
164 0.08
165 0.08
166 0.08
167 0.06
168 0.05
169 0.06
170 0.05
171 0.05
172 0.05
173 0.06
174 0.05
175 0.09
176 0.1
177 0.14
178 0.15
179 0.15
180 0.17
181 0.18
182 0.19
183 0.15
184 0.15
185 0.11
186 0.09
187 0.09
188 0.06
189 0.05
190 0.04
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.04
198 0.04
199 0.04
200 0.06
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.06
207 0.06
208 0.05
209 0.04
210 0.05
211 0.06
212 0.08
213 0.09
214 0.09
215 0.1
216 0.14
217 0.14
218 0.15
219 0.16
220 0.14
221 0.15
222 0.16
223 0.16
224 0.13
225 0.13
226 0.11
227 0.1
228 0.09
229 0.08
230 0.07
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.07
238 0.07
239 0.08
240 0.08
241 0.09
242 0.11
243 0.12
244 0.11
245 0.13
246 0.17
247 0.21
248 0.22
249 0.23
250 0.21
251 0.22
252 0.24
253 0.28
254 0.32
255 0.32
256 0.33
257 0.32
258 0.3
259 0.3
260 0.28
261 0.24
262 0.16
263 0.14
264 0.12
265 0.12
266 0.12
267 0.1
268 0.11
269 0.1
270 0.11
271 0.13
272 0.14
273 0.14
274 0.14
275 0.14
276 0.13
277 0.13
278 0.11
279 0.07
280 0.06
281 0.05
282 0.05
283 0.05
284 0.05
285 0.05
286 0.07
287 0.07
288 0.13
289 0.14
290 0.14
291 0.18
292 0.19
293 0.23
294 0.22
295 0.24
296 0.18
297 0.19
298 0.2
299 0.16
300 0.17
301 0.16
302 0.16
303 0.16
304 0.18
305 0.16
306 0.16
307 0.17
308 0.16
309 0.14
310 0.16
311 0.15
312 0.13
313 0.13
314 0.12
315 0.11
316 0.1
317 0.1
318 0.1
319 0.1
320 0.11
321 0.12
322 0.16
323 0.19
324 0.25
325 0.35
326 0.43
327 0.52
328 0.6
329 0.69
330 0.75
331 0.82
332 0.87
333 0.86
334 0.83
335 0.79
336 0.79
337 0.69
338 0.59
339 0.5
340 0.39
341 0.3
342 0.22
343 0.17
344 0.07
345 0.07
346 0.07
347 0.07
348 0.07