Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A370TH36

Protein Details
Accession A0A370TH36    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
72-102ITYLFCCKRIPRNARRRARRERNTEERRMVLHydrophilic
NLS Segment(s)
PositionSequence
81-93IPRNARRRARRER
Subcellular Location(s) plas 9, mito 5, nucl 4, cyto_mito 4, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPYRADTMGVAGLLKSFHHPDPAPYPPSLTPDILTSTPLAPNNFTADPEPYLGYEPPWLPGGIMGGAVFLITYLFCCKRIPRNARRRARRERNTEERRMVLDNSFRLPWYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.13
5 0.14
6 0.19
7 0.2
8 0.24
9 0.3
10 0.35
11 0.34
12 0.31
13 0.34
14 0.29
15 0.33
16 0.31
17 0.26
18 0.2
19 0.19
20 0.22
21 0.18
22 0.18
23 0.15
24 0.13
25 0.15
26 0.17
27 0.16
28 0.14
29 0.14
30 0.17
31 0.16
32 0.16
33 0.15
34 0.14
35 0.14
36 0.14
37 0.14
38 0.1
39 0.11
40 0.1
41 0.1
42 0.1
43 0.09
44 0.09
45 0.1
46 0.09
47 0.08
48 0.08
49 0.08
50 0.06
51 0.06
52 0.05
53 0.04
54 0.04
55 0.03
56 0.03
57 0.02
58 0.02
59 0.02
60 0.03
61 0.07
62 0.08
63 0.09
64 0.11
65 0.15
66 0.24
67 0.35
68 0.44
69 0.52
70 0.62
71 0.72
72 0.81
73 0.88
74 0.9
75 0.91
76 0.92
77 0.91
78 0.9
79 0.9
80 0.9
81 0.89
82 0.87
83 0.82
84 0.74
85 0.66
86 0.6
87 0.52
88 0.46
89 0.44
90 0.38
91 0.36
92 0.34