Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A370TP17

Protein Details
Accession A0A370TP17    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-102TTAASNPSSRKRPNKKQGGLKALLHydrophilic
NLS Segment(s)
PositionSequence
44-56IPPAPKPHRPKPG
88-96RKRPNKKQG
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
Amino Acid Sequences MILGLDATVEMERPLRKKGRNNTSATKAMVYKCNCCGRKTRHSIPPAPKPHRPKPGSLKATSASAPPSAISQKTTTSSTTAASNPSSRKRPNKKQGGLKALLAKQKASQSSSSSGFGLDLMDFMSKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.39
4 0.49
5 0.59
6 0.66
7 0.71
8 0.76
9 0.76
10 0.75
11 0.72
12 0.64
13 0.56
14 0.49
15 0.43
16 0.43
17 0.38
18 0.35
19 0.37
20 0.45
21 0.44
22 0.43
23 0.49
24 0.49
25 0.57
26 0.63
27 0.64
28 0.63
29 0.67
30 0.74
31 0.73
32 0.75
33 0.75
34 0.72
35 0.71
36 0.71
37 0.73
38 0.75
39 0.69
40 0.67
41 0.66
42 0.71
43 0.69
44 0.61
45 0.56
46 0.46
47 0.46
48 0.38
49 0.29
50 0.19
51 0.14
52 0.12
53 0.09
54 0.1
55 0.1
56 0.1
57 0.11
58 0.11
59 0.12
60 0.14
61 0.16
62 0.15
63 0.15
64 0.16
65 0.15
66 0.16
67 0.15
68 0.15
69 0.15
70 0.18
71 0.21
72 0.27
73 0.33
74 0.39
75 0.49
76 0.57
77 0.67
78 0.74
79 0.8
80 0.83
81 0.86
82 0.88
83 0.86
84 0.78
85 0.71
86 0.68
87 0.61
88 0.58
89 0.49
90 0.4
91 0.35
92 0.38
93 0.38
94 0.33
95 0.31
96 0.3
97 0.34
98 0.36
99 0.34
100 0.28
101 0.25
102 0.22
103 0.19
104 0.16
105 0.11
106 0.08
107 0.07