Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A370U0E5

Protein Details
Accession A0A370U0E5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
23-55KSKNRGSTPTPAPRKKSWKKPRHDRAFDPAKYHBasic
NLS Segment(s)
PositionSequence
28-46GSTPTPAPRKKSWKKPRHD
Subcellular Location(s) cyto 16.5, cyto_nucl 11.5, nucl 5.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR001406  PsdUridine_synth_TruA  
IPR020097  PsdUridine_synth_TruA_a/b_dom  
IPR020095  PsdUridine_synth_TruA_C  
IPR020094  TruA/RsuA/RluB/E/F_N  
Gene Ontology GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01416  PseudoU_synth_1  
Amino Acid Sequences MDYTAWSHDSLVERVAQLETELKSKNRGSTPTPAPRKKSWKKPRHDRAFDPAKYHTRLIALKLAYLGKNYNGFEHHIDTPLSTIEEELWKALNRARLIFPKDTDPLNPGEVNWDGLEYSKCGRTDKGVSAFGQVIGIRVRSNRPLAQKKKSEASGQEGIELVEGQREQGHADAFKAYPGENGVEIRAPPLGRSPRGPHVLDSEPLNIHDPALAEALNFDHIADEIPYCYLLNRLLPPDIRILAWCPAPPTDFSARFSCRERRYKYFFTNPAFPPIPHNLEFANSGKGSGKIKDGWLDIGAMQEAAKLFEGTHDFRNFCKVDASKQISNFERMIYHADISSESAASNKTLGFLNDKNFIPEGFDGEAAPQIYTFNLHGSAFLWHQVRHIVAILFLVGQGLEPPSIVSELLDIAKTPGRPTYEMATDTPLVLWDCIFPRQDDPTRQDALQWIYVGDGVGNAEAKYAAMGLVDVLWEVWREKKIDEVLAGSLLDIVQRQGGEITDLTLSKKPNRSQKVFHGADRPRLQGTYQPVMKKHFMESVDFINDRYAMRKGFENAEDLKRQGYRTRNKAAVEEAENEFVEGVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.16
4 0.14
5 0.18
6 0.17
7 0.2
8 0.24
9 0.24
10 0.31
11 0.34
12 0.4
13 0.41
14 0.45
15 0.46
16 0.51
17 0.6
18 0.64
19 0.71
20 0.72
21 0.73
22 0.77
23 0.83
24 0.84
25 0.85
26 0.85
27 0.85
28 0.88
29 0.93
30 0.94
31 0.94
32 0.93
33 0.88
34 0.87
35 0.88
36 0.8
37 0.74
38 0.7
39 0.67
40 0.62
41 0.56
42 0.48
43 0.43
44 0.42
45 0.41
46 0.4
47 0.33
48 0.3
49 0.32
50 0.33
51 0.28
52 0.28
53 0.26
54 0.22
55 0.27
56 0.27
57 0.26
58 0.24
59 0.26
60 0.27
61 0.3
62 0.28
63 0.25
64 0.25
65 0.22
66 0.21
67 0.19
68 0.17
69 0.12
70 0.11
71 0.1
72 0.13
73 0.13
74 0.13
75 0.14
76 0.14
77 0.16
78 0.18
79 0.22
80 0.22
81 0.25
82 0.29
83 0.35
84 0.4
85 0.43
86 0.42
87 0.41
88 0.42
89 0.4
90 0.37
91 0.32
92 0.28
93 0.27
94 0.25
95 0.2
96 0.21
97 0.2
98 0.2
99 0.17
100 0.15
101 0.11
102 0.13
103 0.14
104 0.11
105 0.13
106 0.16
107 0.17
108 0.19
109 0.2
110 0.24
111 0.28
112 0.34
113 0.37
114 0.36
115 0.35
116 0.36
117 0.36
118 0.31
119 0.27
120 0.19
121 0.15
122 0.13
123 0.13
124 0.11
125 0.13
126 0.17
127 0.2
128 0.25
129 0.28
130 0.37
131 0.47
132 0.55
133 0.62
134 0.66
135 0.67
136 0.69
137 0.67
138 0.63
139 0.56
140 0.55
141 0.51
142 0.44
143 0.4
144 0.33
145 0.29
146 0.23
147 0.19
148 0.12
149 0.08
150 0.07
151 0.07
152 0.07
153 0.08
154 0.08
155 0.09
156 0.11
157 0.09
158 0.1
159 0.12
160 0.11
161 0.12
162 0.12
163 0.11
164 0.1
165 0.11
166 0.11
167 0.1
168 0.1
169 0.1
170 0.11
171 0.1
172 0.1
173 0.11
174 0.1
175 0.1
176 0.17
177 0.21
178 0.22
179 0.26
180 0.3
181 0.35
182 0.41
183 0.42
184 0.36
185 0.36
186 0.37
187 0.33
188 0.31
189 0.26
190 0.21
191 0.21
192 0.22
193 0.16
194 0.14
195 0.13
196 0.11
197 0.1
198 0.1
199 0.09
200 0.06
201 0.07
202 0.07
203 0.07
204 0.06
205 0.05
206 0.05
207 0.05
208 0.06
209 0.06
210 0.06
211 0.05
212 0.05
213 0.06
214 0.06
215 0.06
216 0.06
217 0.07
218 0.09
219 0.1
220 0.12
221 0.14
222 0.14
223 0.15
224 0.17
225 0.16
226 0.14
227 0.13
228 0.14
229 0.14
230 0.14
231 0.13
232 0.12
233 0.12
234 0.13
235 0.13
236 0.16
237 0.19
238 0.2
239 0.22
240 0.26
241 0.28
242 0.3
243 0.34
244 0.37
245 0.39
246 0.47
247 0.5
248 0.53
249 0.58
250 0.63
251 0.65
252 0.66
253 0.65
254 0.59
255 0.61
256 0.54
257 0.52
258 0.47
259 0.4
260 0.35
261 0.33
262 0.33
263 0.26
264 0.27
265 0.2
266 0.2
267 0.22
268 0.19
269 0.17
270 0.13
271 0.12
272 0.12
273 0.14
274 0.15
275 0.14
276 0.15
277 0.13
278 0.14
279 0.16
280 0.15
281 0.14
282 0.13
283 0.12
284 0.1
285 0.09
286 0.08
287 0.06
288 0.05
289 0.05
290 0.05
291 0.05
292 0.05
293 0.04
294 0.04
295 0.06
296 0.09
297 0.11
298 0.15
299 0.17
300 0.18
301 0.18
302 0.24
303 0.23
304 0.2
305 0.24
306 0.2
307 0.22
308 0.3
309 0.35
310 0.32
311 0.34
312 0.38
313 0.35
314 0.37
315 0.33
316 0.25
317 0.2
318 0.18
319 0.2
320 0.16
321 0.15
322 0.12
323 0.12
324 0.11
325 0.12
326 0.11
327 0.07
328 0.06
329 0.07
330 0.07
331 0.07
332 0.07
333 0.06
334 0.07
335 0.07
336 0.08
337 0.12
338 0.14
339 0.17
340 0.21
341 0.21
342 0.21
343 0.21
344 0.2
345 0.18
346 0.16
347 0.16
348 0.12
349 0.12
350 0.1
351 0.1
352 0.12
353 0.1
354 0.1
355 0.07
356 0.06
357 0.06
358 0.07
359 0.07
360 0.07
361 0.08
362 0.08
363 0.08
364 0.08
365 0.1
366 0.09
367 0.13
368 0.14
369 0.13
370 0.13
371 0.15
372 0.14
373 0.13
374 0.14
375 0.1
376 0.09
377 0.09
378 0.08
379 0.06
380 0.06
381 0.05
382 0.04
383 0.03
384 0.04
385 0.04
386 0.04
387 0.04
388 0.04
389 0.05
390 0.05
391 0.06
392 0.05
393 0.05
394 0.06
395 0.07
396 0.07
397 0.06
398 0.07
399 0.1
400 0.11
401 0.11
402 0.14
403 0.16
404 0.18
405 0.2
406 0.23
407 0.24
408 0.25
409 0.25
410 0.25
411 0.23
412 0.21
413 0.19
414 0.16
415 0.13
416 0.11
417 0.1
418 0.09
419 0.1
420 0.13
421 0.14
422 0.14
423 0.16
424 0.23
425 0.3
426 0.34
427 0.38
428 0.4
429 0.42
430 0.41
431 0.39
432 0.37
433 0.34
434 0.3
435 0.25
436 0.19
437 0.16
438 0.17
439 0.15
440 0.1
441 0.07
442 0.05
443 0.05
444 0.06
445 0.06
446 0.06
447 0.06
448 0.06
449 0.05
450 0.05
451 0.05
452 0.04
453 0.04
454 0.04
455 0.04
456 0.04
457 0.04
458 0.04
459 0.04
460 0.05
461 0.06
462 0.1
463 0.13
464 0.15
465 0.15
466 0.21
467 0.24
468 0.25
469 0.26
470 0.24
471 0.22
472 0.22
473 0.21
474 0.15
475 0.12
476 0.09
477 0.09
478 0.07
479 0.06
480 0.07
481 0.07
482 0.07
483 0.08
484 0.08
485 0.1
486 0.09
487 0.1
488 0.11
489 0.11
490 0.14
491 0.17
492 0.21
493 0.26
494 0.34
495 0.4
496 0.49
497 0.58
498 0.62
499 0.66
500 0.73
501 0.76
502 0.72
503 0.7
504 0.69
505 0.65
506 0.68
507 0.65
508 0.58
509 0.5
510 0.47
511 0.43
512 0.38
513 0.41
514 0.4
515 0.41
516 0.43
517 0.45
518 0.5
519 0.53
520 0.49
521 0.45
522 0.42
523 0.38
524 0.38
525 0.37
526 0.36
527 0.37
528 0.35
529 0.32
530 0.28
531 0.28
532 0.24
533 0.24
534 0.23
535 0.19
536 0.21
537 0.25
538 0.27
539 0.31
540 0.32
541 0.34
542 0.36
543 0.41
544 0.43
545 0.39
546 0.4
547 0.37
548 0.38
549 0.41
550 0.45
551 0.49
552 0.54
553 0.63
554 0.64
555 0.63
556 0.64
557 0.63
558 0.59
559 0.53
560 0.49
561 0.42
562 0.39
563 0.37
564 0.33