Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A370TGM8

Protein Details
Accession A0A370TGM8    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKIPWRLSKFQKARQRKRLRAVDSVHydrophilic
77-100KYTIFDRKEKKYRKSIRSEHPPELBasic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTNALSGGLLWKIPWRLSKFQKARQRKRLRAVDSVVATLDKALAKQSITTKAVERWKGEMPVEQEMVPKDKYTIFDRKEKKYRKSIRSEHPPELVGARNYTDWVLELPKWTRVSQRINPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.15
5 0.16
6 0.19
7 0.24
8 0.28
9 0.37
10 0.45
11 0.55
12 0.6
13 0.67
14 0.75
15 0.79
16 0.84
17 0.86
18 0.89
19 0.87
20 0.89
21 0.89
22 0.84
23 0.8
24 0.73
25 0.68
26 0.58
27 0.49
28 0.39
29 0.29
30 0.23
31 0.16
32 0.13
33 0.07
34 0.06
35 0.07
36 0.07
37 0.07
38 0.1
39 0.13
40 0.17
41 0.18
42 0.19
43 0.2
44 0.25
45 0.31
46 0.31
47 0.3
48 0.27
49 0.28
50 0.29
51 0.28
52 0.25
53 0.22
54 0.21
55 0.21
56 0.18
57 0.17
58 0.16
59 0.18
60 0.16
61 0.13
62 0.12
63 0.12
64 0.15
65 0.19
66 0.27
67 0.28
68 0.36
69 0.43
70 0.51
71 0.59
72 0.65
73 0.67
74 0.69
75 0.77
76 0.77
77 0.81
78 0.81
79 0.82
80 0.84
81 0.84
82 0.78
83 0.71
84 0.62
85 0.52
86 0.46
87 0.4
88 0.3
89 0.24
90 0.21
91 0.18
92 0.18
93 0.17
94 0.15
95 0.11
96 0.12
97 0.14
98 0.13
99 0.18
100 0.19
101 0.25
102 0.28
103 0.29
104 0.35
105 0.4
106 0.48
107 0.51
108 0.6