Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A370TL80

Protein Details
Accession A0A370TL80    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MDKRNKAEQFRKAKKNFFKRGYKIGLKHydrophilic
NLS Segment(s)
PositionSequence
11-16RKAKKN
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MDKRNKAEQFRKAKKNFFKRGYKIGLKSDAEIFILIKRKDKSYSFTNTNLPFCTCQAIDYNKTIAKTATDFEPTSSQERNTGFSQAICKDSALSILGIKAPTPPQLEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.87
4 0.85
5 0.86
6 0.81
7 0.82
8 0.81
9 0.78
10 0.72
11 0.67
12 0.66
13 0.56
14 0.52
15 0.45
16 0.37
17 0.29
18 0.24
19 0.19
20 0.15
21 0.21
22 0.19
23 0.23
24 0.24
25 0.26
26 0.3
27 0.31
28 0.33
29 0.32
30 0.39
31 0.37
32 0.39
33 0.42
34 0.41
35 0.4
36 0.36
37 0.31
38 0.25
39 0.21
40 0.21
41 0.14
42 0.12
43 0.14
44 0.17
45 0.18
46 0.18
47 0.2
48 0.19
49 0.2
50 0.19
51 0.16
52 0.14
53 0.13
54 0.13
55 0.13
56 0.15
57 0.14
58 0.16
59 0.18
60 0.19
61 0.22
62 0.22
63 0.2
64 0.22
65 0.23
66 0.25
67 0.23
68 0.23
69 0.2
70 0.2
71 0.25
72 0.22
73 0.23
74 0.2
75 0.19
76 0.17
77 0.17
78 0.17
79 0.13
80 0.11
81 0.1
82 0.1
83 0.12
84 0.12
85 0.12
86 0.14
87 0.15
88 0.2