Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A370U3A5

Protein Details
Accession A0A370U3A5    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKTTKRAATKRGEKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
5-27KTTKRAATKRGEKKKKDPNAPKR
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTKRAATKRGEKKKKDPNAPKRGLSAYMFFANEQRDNVREENPGITFGQVGKVLGERWKALNDKQRGPYEAKAAVDKKRYEDEKAIYLVLPQAADAEEDEST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.86
4 0.87
5 0.89
6 0.89
7 0.89
8 0.89
9 0.89
10 0.89
11 0.87
12 0.8
13 0.74
14 0.66
15 0.58
16 0.49
17 0.4
18 0.32
19 0.28
20 0.25
21 0.21
22 0.21
23 0.2
24 0.19
25 0.18
26 0.16
27 0.15
28 0.18
29 0.19
30 0.19
31 0.17
32 0.17
33 0.18
34 0.16
35 0.17
36 0.13
37 0.12
38 0.1
39 0.09
40 0.09
41 0.08
42 0.07
43 0.06
44 0.06
45 0.07
46 0.09
47 0.11
48 0.1
49 0.11
50 0.15
51 0.17
52 0.21
53 0.29
54 0.32
55 0.37
56 0.43
57 0.45
58 0.45
59 0.47
60 0.45
61 0.41
62 0.38
63 0.33
64 0.33
65 0.34
66 0.37
67 0.39
68 0.38
69 0.37
70 0.42
71 0.44
72 0.43
73 0.45
74 0.43
75 0.41
76 0.41
77 0.38
78 0.3
79 0.28
80 0.25
81 0.19
82 0.15
83 0.1
84 0.1
85 0.09
86 0.1
87 0.1