Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1DP41

Protein Details
Accession A1DP41   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
216-248QRSESTKRSSSDRKKRGKRNPFRKLRSFARSLRHydrophilic
NLS Segment(s)
PositionSequence
223-254RSSSDRKKRGKRNPFRKLRSFARSLRRGRLFR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
KEGG nfi:NFIA_059130  -  
Amino Acid Sequences MGLGLMNHSETFRARLARFPEAEAQEQTFTPGHTKARSDSMLLELRRPTATIEHQGTSFEILNPHESLKFARIVSYIEDVDNSSITDDQRDSFNATRPQSETLILEQDETVEASHDYNQVHDHYISDADEERVHYELIGDIPYQPMPSISERLEGNETDIPQSHKWSSPPQSRPMTAQSYGSELGEPGYSVLASYDGAGWTSTTDDILAMKYDEMQRSESTKRSSSDRKKRGKRNPFRKLRSFARSLRRGRLFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.3
3 0.35
4 0.41
5 0.41
6 0.41
7 0.45
8 0.43
9 0.45
10 0.41
11 0.38
12 0.32
13 0.3
14 0.3
15 0.22
16 0.19
17 0.19
18 0.2
19 0.22
20 0.24
21 0.27
22 0.26
23 0.32
24 0.33
25 0.31
26 0.29
27 0.3
28 0.34
29 0.32
30 0.34
31 0.28
32 0.29
33 0.28
34 0.27
35 0.22
36 0.2
37 0.24
38 0.28
39 0.3
40 0.29
41 0.29
42 0.29
43 0.28
44 0.25
45 0.22
46 0.15
47 0.14
48 0.13
49 0.16
50 0.16
51 0.17
52 0.14
53 0.14
54 0.15
55 0.15
56 0.17
57 0.15
58 0.15
59 0.15
60 0.16
61 0.17
62 0.19
63 0.17
64 0.13
65 0.14
66 0.13
67 0.13
68 0.12
69 0.09
70 0.07
71 0.08
72 0.08
73 0.09
74 0.09
75 0.09
76 0.1
77 0.11
78 0.15
79 0.15
80 0.21
81 0.26
82 0.27
83 0.28
84 0.29
85 0.3
86 0.27
87 0.26
88 0.21
89 0.16
90 0.18
91 0.15
92 0.14
93 0.11
94 0.1
95 0.09
96 0.08
97 0.07
98 0.05
99 0.05
100 0.05
101 0.07
102 0.09
103 0.08
104 0.09
105 0.1
106 0.1
107 0.12
108 0.11
109 0.1
110 0.09
111 0.09
112 0.09
113 0.08
114 0.08
115 0.07
116 0.08
117 0.08
118 0.08
119 0.08
120 0.08
121 0.07
122 0.07
123 0.06
124 0.06
125 0.07
126 0.06
127 0.05
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.07
134 0.09
135 0.12
136 0.12
137 0.14
138 0.14
139 0.16
140 0.18
141 0.15
142 0.17
143 0.16
144 0.16
145 0.14
146 0.15
147 0.17
148 0.16
149 0.2
150 0.18
151 0.18
152 0.21
153 0.27
154 0.35
155 0.41
156 0.45
157 0.5
158 0.53
159 0.52
160 0.53
161 0.51
162 0.47
163 0.39
164 0.36
165 0.29
166 0.27
167 0.27
168 0.23
169 0.18
170 0.13
171 0.12
172 0.1
173 0.09
174 0.06
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.06
183 0.05
184 0.06
185 0.06
186 0.06
187 0.06
188 0.07
189 0.07
190 0.06
191 0.06
192 0.06
193 0.07
194 0.08
195 0.08
196 0.07
197 0.07
198 0.11
199 0.15
200 0.18
201 0.19
202 0.21
203 0.22
204 0.27
205 0.31
206 0.34
207 0.35
208 0.37
209 0.38
210 0.43
211 0.52
212 0.58
213 0.65
214 0.7
215 0.76
216 0.81
217 0.9
218 0.93
219 0.93
220 0.94
221 0.94
222 0.94
223 0.94
224 0.94
225 0.92
226 0.9
227 0.88
228 0.85
229 0.82
230 0.8
231 0.79
232 0.79
233 0.76
234 0.78