Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L5L8

Protein Details
Accession E2L5L8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-81DSAPKVPPKSSKKKGSQHADVIHydrophilic
NLS Segment(s)
PositionSequence
64-73KVPPKSSKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
KEGG mpr:MPER_01066  -  
Amino Acid Sequences MAGQESNPFLDPPRTMEIEKAVRETVTVRGGHRIGRSHTQHPAPPAKQSAPSPRRSQSQDSAPKVPPKSSKKKGSQHADVIDRLDYSGVGGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.27
4 0.31
5 0.33
6 0.34
7 0.31
8 0.27
9 0.24
10 0.24
11 0.24
12 0.2
13 0.19
14 0.19
15 0.17
16 0.21
17 0.23
18 0.25
19 0.26
20 0.26
21 0.25
22 0.32
23 0.35
24 0.34
25 0.39
26 0.38
27 0.38
28 0.4
29 0.44
30 0.36
31 0.35
32 0.34
33 0.3
34 0.3
35 0.32
36 0.37
37 0.35
38 0.39
39 0.42
40 0.42
41 0.47
42 0.48
43 0.5
44 0.45
45 0.49
46 0.54
47 0.54
48 0.56
49 0.54
50 0.56
51 0.52
52 0.52
53 0.51
54 0.51
55 0.58
56 0.62
57 0.68
58 0.71
59 0.79
60 0.84
61 0.84
62 0.82
63 0.79
64 0.77
65 0.71
66 0.63
67 0.55
68 0.46
69 0.37
70 0.29
71 0.22
72 0.14