FuNGI

A0A370TUZ5

Protein Details

Accession

A0A370TUZ5

Localization Confidence

Low

Confidence Score

9.7

NoLS Segment(s)

Position	Sequence	Protein Nature
18-47	QLKVPVGRYAQRRRRRRGNNLQNANKKSVQ	Hydrophilic

NLS Segment(s)

Position	Sequence
29-34	RRRRRR

Subcellular Location(s)

mito 10.5, cyto_mito 10, cyto 8.5, nucl 6

Family & Domain DBs

InterPro	View protein in InterPro IPR021858 Fun_TF
Pfam	View protein in Pfam PF11951 Fungal_trans_2

Amino Acid Sequences

MIAPGGDGSASNGTSPIQLKVPVGRYAQRRRRRRGNNLQNANKKSVQEPGAAAMATALPVARLSPQPPSKAVAPYIPRSESEDTHLRFLIYHYVTVVNMRTLTCVGPRFEWYPLAVRDEAFFHVLMSSTSSHAAYLQKTELPRNFFYHRGIAIQLLNERIARGAHDEGTINTICLFAQQEAFEGRPRTAKTHIEGLLQLVRAAGGIKSVELPEKTRRHIFFTDLAAAITLSTKPILRPLLDILDFPTHFGRPSEATASYAKTFGMRLYNFSNSPLSNQAATVMWGLRNLSQLAEDFHQGKAVLDTALASDMQFTDRVEVLERLVHDLWYAENQATPQHTLFRTFGWTCLIYIYTILRELPRELGMNAMLAGRIKLALESCSELNVLLATFQDLLLWQMFVCGRVADERDRPFFASQATKILLVRKLENADEILVAAQEFIWPERRVSMESPSNSTESSGRADSAIMDVGE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.15
2	0.17
3	0.16
4	0.16
5	0.18
6	0.21
7	0.27
8	0.31
9	0.33
10	0.35
11	0.4
12	0.47
13	0.57
14	0.65
15	0.68
16	0.75
17	0.79
18	0.86
19	0.9
20	0.91
21	0.91
22	0.92
23	0.93
24	0.94
25	0.94
26	0.93
27	0.87
28	0.83
29	0.75
30	0.66
31	0.56
32	0.53
33	0.46
34	0.39
35	0.35
36	0.31
37	0.29
38	0.27
39	0.24
40	0.17
41	0.14
42	0.1
43	0.09
44	0.06
45	0.04
46	0.05
47	0.05
48	0.08
49	0.1
50	0.12
51	0.21
52	0.27
53	0.3
54	0.32
55	0.35
56	0.36
57	0.38
58	0.38
59	0.36
60	0.37
61	0.39
62	0.43
63	0.41
64	0.38
65	0.4
66	0.41
67	0.35
68	0.36
69	0.39
70	0.35
71	0.37
72	0.36
73	0.3
74	0.27
75	0.27
76	0.29
77	0.22
78	0.2
79	0.18
80	0.19
81	0.18
82	0.2
83	0.2
84	0.13
85	0.13
86	0.13
87	0.13
88	0.13
89	0.14
90	0.16
91	0.18
92	0.19
93	0.19
94	0.23
95	0.24
96	0.24
97	0.25
98	0.22
99	0.25
100	0.25
101	0.27
102	0.24
103	0.22
104	0.21
105	0.22
106	0.22
107	0.17
108	0.15
109	0.11
110	0.1
111	0.1
112	0.1
113	0.1
114	0.09
115	0.09
116	0.1
117	0.1
118	0.1
119	0.12
120	0.15
121	0.14
122	0.15
123	0.16
124	0.18
125	0.2
126	0.26
127	0.28
128	0.31
129	0.32
130	0.35
131	0.36
132	0.36
133	0.37
134	0.35
135	0.31
136	0.27
137	0.25
138	0.22
139	0.2
140	0.19
141	0.17
142	0.15
143	0.15
144	0.13
145	0.13
146	0.11
147	0.1
148	0.09
149	0.11
150	0.11
151	0.11
152	0.12
153	0.13
154	0.12
155	0.16
156	0.15
157	0.11
158	0.1
159	0.09
160	0.08
161	0.08
162	0.09
163	0.06
164	0.08
165	0.08
166	0.09
167	0.1
168	0.11
169	0.13
170	0.13
171	0.13
172	0.17
173	0.18
174	0.2
175	0.23
176	0.26
177	0.25
178	0.31
179	0.31
180	0.28
181	0.27
182	0.26
183	0.24
184	0.21
185	0.18
186	0.11
187	0.1
188	0.08
189	0.08
190	0.06
191	0.04
192	0.04
193	0.04
194	0.05
195	0.06
196	0.08
197	0.08
198	0.12
199	0.2
200	0.23
201	0.27
202	0.32
203	0.33
204	0.37
205	0.37
206	0.37
207	0.32
208	0.31
209	0.3
210	0.23
211	0.22
212	0.16
213	0.15
214	0.11
215	0.08
216	0.06
217	0.04
218	0.04
219	0.05
220	0.05
221	0.09
222	0.1
223	0.1
224	0.11
225	0.12
226	0.15
227	0.15
228	0.15
229	0.13
230	0.15
231	0.14
232	0.14
233	0.14
234	0.11
235	0.11
236	0.12
237	0.11
238	0.1
239	0.11
240	0.13
241	0.12
242	0.14
243	0.15
244	0.16
245	0.15
246	0.14
247	0.13
248	0.11
249	0.11
250	0.1
251	0.15
252	0.13
253	0.15
254	0.18
255	0.21
256	0.21
257	0.22
258	0.23
259	0.17
260	0.19
261	0.19
262	0.17
263	0.14
264	0.14
265	0.13
266	0.11
267	0.12
268	0.11
269	0.09
270	0.08
271	0.08
272	0.09
273	0.09
274	0.1
275	0.1
276	0.09
277	0.09
278	0.09
279	0.11
280	0.11
281	0.12
282	0.12
283	0.11
284	0.12
285	0.12
286	0.11
287	0.1
288	0.1
289	0.08
290	0.06
291	0.07
292	0.06
293	0.06
294	0.06
295	0.05
296	0.05
297	0.05
298	0.06
299	0.07
300	0.06
301	0.08
302	0.08
303	0.09
304	0.11
305	0.11
306	0.11
307	0.12
308	0.13
309	0.15
310	0.15
311	0.14
312	0.12
313	0.12
314	0.12
315	0.12
316	0.12
317	0.08
318	0.09
319	0.09
320	0.12
321	0.13
322	0.15
323	0.13
324	0.18
325	0.18
326	0.21
327	0.21
328	0.2
329	0.25
330	0.23
331	0.23
332	0.22
333	0.22
334	0.18
335	0.19
336	0.18
337	0.12
338	0.12
339	0.12
340	0.09
341	0.1
342	0.1
343	0.1
344	0.12
345	0.13
346	0.14
347	0.15
348	0.15
349	0.14
350	0.16
351	0.15
352	0.13
353	0.12
354	0.1
355	0.09
356	0.08
357	0.08
358	0.06
359	0.06
360	0.06
361	0.07
362	0.07
363	0.08
364	0.1
365	0.12
366	0.12
367	0.13
368	0.13
369	0.12
370	0.11
371	0.1
372	0.08
373	0.06
374	0.06
375	0.06
376	0.06
377	0.06
378	0.06
379	0.06
380	0.08
381	0.08
382	0.08
383	0.07
384	0.09
385	0.09
386	0.1
387	0.11
388	0.09
389	0.09
390	0.13
391	0.16
392	0.19
393	0.26
394	0.31
395	0.34
396	0.37
397	0.39
398	0.36
399	0.34
400	0.34
401	0.33
402	0.29
403	0.31
404	0.3
405	0.29
406	0.29
407	0.33
408	0.34
409	0.3
410	0.31
411	0.31
412	0.33
413	0.32
414	0.33
415	0.28
416	0.25
417	0.21
418	0.19
419	0.14
420	0.11
421	0.1
422	0.08
423	0.06
424	0.06
425	0.07
426	0.09
427	0.15
428	0.16
429	0.17
430	0.21
431	0.23
432	0.26
433	0.28
434	0.35
435	0.37
436	0.39
437	0.43
438	0.43
439	0.42
440	0.38
441	0.38
442	0.31
443	0.25
444	0.26
445	0.22
446	0.2
447	0.19
448	0.19
449	0.17
450	0.18

A0A370TUZ5

3D AlphaFold-predicted Structure Viewer